KEGG   Columba livia (rock pigeon): 102083946Help
Entry
102083946         CDS       T02912                                 

Gene name
CDK5RAP2
Definition
(RefSeq) CDK5 regulatory subunit-associated protein 2 isoform X1
  KO
K16542  CDK5 regulatory subunit-associated protein 2
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102083946 (CDK5RAP2)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     102083946 (CDK5RAP2)
   Centrosome duplication proteins
    Regulators of centriole replication
     102083946 (CDK5RAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cnn_1N HALZ
Motif
Other DBs
NCBI-GeneID: 102083946
NCBI-ProteinID: XP_013222392
UniProt: A0A2I0LWA8
Position
Unknown
AA seq 1905 aa AA seqDB search
MKDYENQITDLKKENFNLKLRIYFLEERMQQKFDGPTEEIYKINIELKVEIESLKRDLQE
REKLLIKASKAVESLAQGGEAEIQRVKEEAQKKMQEMEKILTSRINLLEENLKTAQEDVE
KATAMTEKEKALRTAAEQKLSSIMNAPAKDVDTITGAEKDRLIEQLNLSLKSKEAQIQHL
EEEKAQSGDGNLSAEKIRELTIALRHEKDSEIEAIRMELRNERNSFEKKIQSLQEELQER
ENELAVEKKNGLKRDKTIQGLTVALKAKEKENEELGSEIEDLNASLAKAREATHKAHVQK
FKGAEDYQALLMEKETLLAELRSENLTKDAENRKLQRRIKRTDQELSDLNLEREKMEKEL
DEAQLQKSRSDKTINDLRNQLEKLHGEMSEKEKAVEHHYNILLSESNQKLQSQELVIKQL
TDNANQKELLLQKLDGTVKEKDAELQELLNKYKNLLRANEELELRNEGLVKEKCAAQSQQ
SIIKIVRELEENKEAEYEKLILALRKEQNIYSTLVKTFKESDSLNSLQTELNNIFMLRKQ
LEEDVLANRNLQKVLEDQIKGIKNRQDETQSFCGDQTSYMSICLGEQDHLSLQIDHLSLE
ELKKKVTDLLLLVKDLQSINQELKKKQLGCCSTDSQGKEALKILNHSECLEITEEPVMET
EDGDNDRKKRNSPFSERVSQVCLQVSLDFPCEVDKQITPSGYSESFCKDRHYRSPNKPQF
EHDTNGKHFDRTGMSEHETEENLLTSPLRENRTSVLESTRQEQMKIVNELLDHLNTTEEE
CSSEDIEEKDEKDLRQMIIQLRAELKHFKQVNKFLKRQVELKSTFDGKEKLYLDAVPQIN
KDIELLKAELKDATTQTMTLESNVMRVKHEGKKGASEEKPKYSRLNAEREHQQENVYKEG
EQHERLFYKRRANETDSTYLHKKSRLPILLKSSRSLGKVPLNSCMQKSDSKLQTNEGLKA
CEVQTKQLEAQTNGELVSNESVTENLEEEPAQESTSVRADSLKPDHSDIQVELQGVDLGT
GDENECVMDKNQQNYQEMQNHHNICNTNNQRSLKEINEEFYSVEHEDVDLATTYPASKCL
RSLQSSVTSTDALDDCEVIDDIEELKCRIKNMKSELEKYKMFVFNLQTSDQLLSSDFSNI
VLSDTALPAERHGTQVQDTAVQEIKTLPSVHQLMDYKLHTENRNSESSEAPNTWTAQNLK
ELLSANEAELEKEQIANMHLDELYHLQNKLRETSPSKYDSLVHSQAQELSYQRQQIKEIC
SACVAYHQHLTSLIKAFEELLQASDVDYYVAEGFREQLNQSVLLFEKLERKFLYGESIDT
EGTILYELAQRDNEKNTTMYQQLKDESPVPSALHSLSDFDLSEKSSLGSPEHRPDLEGQH
STLALLPNKFPPELLMEHLQEIRILRQRLEHSIKTNERLRKQLERQVTDKELDQGSANIF
IHGSEQHNSLTSEIHFLRKQNQVLNAMLAKGSRDKQKENEKLRESLSKKNVIIEHLQEDY
ECIKKENERLQKQIGQKEDETRYLTCQIYSSRNELNRLQTEINIKQHQLSENEKLLQSLR
TESKVYEKLEEARRKRTDPRCDASEEFRKDQNNPLDLHELLTEIQSLRVQLERSIETNKS
LHEKLEEQLSKEKREEAGSVSAVNINYLVKQESQHYAGMNENLCKCPATGRNISELRKHG
HCLSLAKPGTHPASKDDVDSTSHCSSTSSSSTACTPRLVPGHRMWADKNGRHVLGLIEDY
NALRKQISEGQQVLGEMEISLRKVTGTKLQESGIKVPDQTSLHSFSANIHTVQQILEEAA
RLLKLLWRVSLPLKAGPGTAHGTQDEGMKAEILRLRKKLSEQEKKLHSTVKRLHSTNQLK
ENMEKVIIDQLVLTHDVLKKARGNLEVPAAENQKSPTYTSKKRIL
NT seq 5718 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactatgaaaatcaaatcactgatctgaaaaaagagaacttcaacctgaagctc
cgtatatactttttggaggagcgaatgcagcagaaatttgatggtcccactgaagaaata
tacaaaattaacattgagctgaaagtcgagatagaaagtctgaagcgtgatctgcaggag
agagagaaactgctcatcaaagcctctaaggcagttgaaagcttggcccagggtggtgaa
gctgaaatacagcgtgtgaaagaagaggcacaaaagaagatgcaggaaatggagaaaatc
ctgactagcagaataaaccttctggaagagaatcttaaaactgcccaagaagatgtggaa
aaagctactgcaatgacagagaaagagaaagctctgagaacagctgctgagcagaaactt
tcttcaattatgaatgcccctgcaaaggatgtggatacgattacaggagctgagaaggac
agacttatagagcaactgaatctgtcattgaaaagtaaagaagctcaaattcaacacctg
gaagaggaaaaggctcagagtggagatgggaacttatcagcagaaaaaatcagagaactt
accatcgctttgaggcatgaaaaagatagtgagatagaggctattagaatggagcttaga
aatgagagaaattcctttgaaaaaaagattcagtcacttcaagaagagctgcaagagaga
gaaaacgagcttgctgtggaaaagaagaatggtttgaaaagggataaaaccattcaaggg
ctaacggtggcattaaaagcaaaggaaaaagagaatgaggagcttggttctgaaatagaa
gatctaaatgcttcattggcaaaggcaagagaggcaactcacaaagcacacgtccaaaaa
ttcaagggtgctgaggattatcaagctctcttgatggaaaaagagaccctcttagcagag
ctgcgttcagaaaaccttacaaaggatgctgagaatcgtaaactacaaaggaggattaaa
aggaccgatcaagagctaagcgatttgaatttagaaagagagaaaatggagaaggagctg
gatgaagcacaactccagaagagcagaagtgacaaaaccattaatgaccttagaaatcaa
ctagagaaattacatggtgaaatgagtgagaaagaaaaagcagttgaacatcattacaat
attcttttgagtgaaagcaatcagaagttgcagagccaagaactagttatcaagcagctg
acagacaatgccaatcaaaaggagctactgcttcagaaacttgatggaacagtgaaagaa
aaggatgcagaattgcaggagctcctgaataagtacaagaaccttctaagagccaatgaa
gaacttgaactgagaaatgagggcttagtaaaggaaaaatgtgctgcacagtctcaacag
tcaatcatcaagatagtccgagagttagaggaaaataaagaagctgaatacgaaaagctg
atccttgctttaagaaaggaacagaatatttattctacactagtgaagaccttcaaagaa
tcggatagtctaaacagcttgcaaacagaactaaacaacattttcatgttgcggaaacaa
ctagaagaggacgttttagctaatcggaatctgcagaaggtcttagaagatcagattaag
ggcattaaaaaccgccaagatgaaacgcaatcgttctgtggagatcaaacatcttatatg
agtatctgtttaggagagcaagaccatttaagcctacagatagaccatctatctcttgaa
gagcttaagaaaaaggttactgaccttctcttgctggttaaggatctgcagtcaattaac
caagagcttaagaaaaaacagcttgggtgttgttcaacggattctcaagggaaggaagca
ctgaaaatattaaaccacagtgagtgtcttgaaataacagaggagcctgtgatggagact
gaagatggtgacaatgacaggaagaaacggaacagtccattttctgagagggtcagccag
gtatgccttcaggtatctttggattttccttgtgaggtggataaacagatcactccatca
ggctattcagagagtttttgcaaagatagacattataggagtccaaataagcctcagttt
gaacatgatacaaatgggaaacactttgacagaacaggaatgagtgaacatgaaacagaa
gagaacttgctcacatctcctttaagagaaaatagaacatctgtactggaatctaccaga
caagaacaaatgaaaattgtaaatgaactgttagatcatctgaacacaaccgaggaagaa
tgttcaagtgaagatatagaggaaaaggatgaaaaagatctcagacaaatgattattcaa
ctaagagctgaactcaaacatttcaagcaggtcaataaattcttaaagcggcaagtagaa
ttgaaatcaacttttgatgggaaagagaagctttatctggatgcagtgccgcagattaat
aaggatatagagttgttgaaagcggaattgaaagatgcaactacacaaacaatgacttta
gagagtaatgtcatgagagtcaaacatgaaggcaaaaaaggagcctcagaagaaaagcca
aaatattcaagattaaatgcagaaagagaacatcagcaagaaaatgtgtacaaggagggt
gaacagcatgaaagacttttctataaaaggagagcaaatgaaactgattctacttacctg
cacaagaagtcccgtctgcccattctcttaaaatcatccagatcattaggaaaagtgcct
ttgaactcctgcatgcagaagtcagattccaaactacaaactaatgaaggtctgaaagca
tgtgaagtacaaaccaaacaacttgaggcacaaacaaatggagagttggtatcgaatgag
tctgtaactgaaaacctggaagaagagcctgcacaggaaagcacatcagtgagagctgac
tcgctcaaaccggatcatagtgacatccaggtggagttgcaaggtgttgatctgggtaca
ggggacgaaaatgaatgtgtgatggacaaaaatcagcaaaactatcaagaaatgcaaaat
catcataacatttgcaacacgaacaaccagcgttcattaaaagagataaatgaagagttt
tattccgtggaacatgaggacgttgacttggccaccacatatccagcttccaagtgccta
cgttctctccaatcaagtgtaacaagtacagatgcacttgatgactgtgaagtcatagat
gatatagaagaattgaaatgcagaattaagaacatgaagtctgagcttgaaaagtacaaa
atgttcgtgtttaatttacagacctctgaccagcttttatcgagcgatttttccaatata
gttttgagtgacacggccttgcctgcggaaagacatggtacacaagtgcaagatacagct
gtgcaagaaatcaagacacttcctagtgtacatcagttgatggattacaaactccacact
gaaaataggaattcagagtcttcagaagcacccaatacatggacagcacaaaaccttaag
gaactgctgtcagcgaatgaggcggaacttgaaaaagagcaaattgcaaatatgcatctt
gatgaattgtatcatcttcagaacaaactgagagaaacatcaccatccaagtatgattca
ttagttcattcacaagctcaagaactctcctatcaacgccagcaaattaaagagatctgc
agtgcctgtgtcgcttaccatcagcatctgacgagccttattaaagcttttgaggaactg
cttcaggccagcgatgtagattattacgttgctgaaggcttccgtgaacagctgaatcaa
agtgtgctcttgtttgagaagctagaaaggaaattcctgtatggagaatcgatagataca
gaaggtactatactttatgaattagctcaaagggataatgagaagaacaccacaatgtac
cagcaactgaaggatgaatcgcctgtaccatctgctcttcatagcttgtctgactttgat
ttgtcagaaaagtcctcccttggatcacctgagcacaggcctgacctggaaggacagcac
agcacactggcgcttctgccaaacaaatttcccccagagttattaatggagcatctgcaa
gaaattcgaatcctgagacaacgtttagagcactccataaaaactaatgagagactgagg
aagcagcttgagagacaagtaacagacaaggaactagatcaaggttctgcaaacattttt
atccatggctcagagcagcataattccctgacttctgaaatacatttcctgaggaagcaa
aatcaagttctgaatgcaatgctagcaaaaggatccagagataaacaaaaggaaaatgaa
aagttaagagaatcgctttctaaaaagaatgtaatcattgagcatcttcaagaggattat
gaatgcatcaagaaagaaaatgaaaggttgcaaaaacaaattggccaaaaggaggatgaa
accagatatctgacatgtcagatttacagcagtcgtaatgaattaaacaggttgcagaca
gaaattaacatcaagcaacatcagctttctgagaatgagaagttactgcagtcacttcga
accgagagcaaggtttatgagaagctggaagaggcaagaaggaagaggacagatcccaga
tgcgatgcgtcagaagaattccgaaaagatcagaataatccacttgacttacatgaacta
ttgactgaaatacagagtttacgagtgcagctcgaaagaagcatagagacaaacaagtct
ttgcatgaaaaattagaggaacagctttcgaaagagaagagagaggaagcgggatcagtg
tcagccgtgaatatcaactatcttgtcaaacaagaatctcagcattatgcaggaatgaac
gaaaatctttgcaaatgccctgctactggcagaaacatttctgagctgcggaaacacgga
cattgcctttcactggcaaaaccaggtacgcatccagcttctaaagatgatgtagacagc
acttcacactgcagcagcacctcgtcgtccagcacggcctgtaccccccgcctggtgccc
ggacatcggatgtgggcggacaaaaacgggcgccacgtccttggcttgatcgaggattat
aatgctctgcggaaacagatttcagaagggcaacaggttttaggagaaatggagatttct
ttaagaaaggtcactggtacgaaactgcaggagtccgggataaaggtaccggaccagaca
tcactgcacagcttttctgcaaatattcacacagtacagcaaattttagaagaggctgca
cgtttactgaagcttctctggagagtttccctgcccctgaaagctggacctggtactgct
catggcactcaggatgaaggaatgaaagcagaaatattgagattacgtaagaaattgtcc
gagcaagagaagaagttacacagcaccgtgaaacgcttgcactccaccaaccagctgaag
gaaaacatggagaaagtcatcattgaccagctggttttaactcacgatgtcttgaagaaa
gctagaggaaacctggaagtgccagcagctgagaatcaaaaatcacctacctataccagc
aaaaagaggattctctga

DBGET integrated database retrieval system