KEGG   Columba livia (rock pigeon): 102083959Help
Entry
102083959         CDS       T02912                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00564  Glycerophospholipid metabolism
clv00565  Ether lipid metabolism
clv00590  Arachidonic acid metabolism
clv00591  Linoleic acid metabolism
clv00592  alpha-Linolenic acid metabolism
clv01100  Metabolic pathways
clv04010  MAPK signaling pathway
clv04217  Necroptosis
clv04270  Vascular smooth muscle contraction
clv04370  VEGF signaling pathway
clv04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102083959
   00565 Ether lipid metabolism
    102083959
   00590 Arachidonic acid metabolism
    102083959
   00591 Linoleic acid metabolism
    102083959
   00592 alpha-Linolenic acid metabolism
    102083959
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102083959
   04370 VEGF signaling pathway
    102083959
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102083959
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102083959
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102083959
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102083959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 102083959
NCBI-ProteinID: XP_021143209
Position
Unknown
AA seq 813 aa AA seqDB search
MYLFEKECNTCFLDPSLSCFPSPTVSQSDCYVSLSLPTASVQHFRTKTVKNSKNPTWNET
FHFTIQSQVKNILELKVCDEDNITEDDHLLTVFFDVSKIQLGENIRLSFQLNPQGKEELE
VEFTMESSPDPPENIVTNGVLVSREVACLDVQVNGGRLRKDSSERKFALTVDGSYEGTRT
HTLSSCLCPTSPARFHYIKYNQSALTVALPRRRRLSRSISSQNESDMNESVTLALNSLPI
QEKITIAEDRTIDLYTKASEWTQGLFYRPRNLDARLGFELCPDEQNFLQNRRKVVAAALK
DVLHLEEDLQEHEVPIVAVTTAGCGIRALTAMYGSILGLQKLRVLDCITYISGSSGTTWT
MTKLYEDADWSRKDIGEIIIEARKQAAKCKMGSFCLRSLRNYYRELSQRTQAGHKTSFID
LWGLMIESMLNDGKCYHRLSDQRRAVNQGQNPLPIYLALNVKDKFATKDFREWVEFTPYE
VGFLKYGAFIRAEDFGSEFFMGRLMKKLPESRICFMQGMWSSIFSKNLLDAWHAADNSED
FWNRWTQNKVTEIEEQPDLPEKPHEMATCMFTPTSGLSTALRDILTDRPAVSKYHNFLRG
FQMHNEYIQQEHFAKWKDTLLDTSPNDLRVNSEHLELVDAAFFFETSCPPLMRPERNVDV
IIHLNYTGGSQTLPLEQACRYFSEQGIPFPSVGLKDDEQNLKECYMFDGTDTPGAPLLLY
FPLVNDTFQRYAAPGIARSAAEIEQGKVDISGFCSPYSTREVSLKAEDFNKLLKLTNYNI
MNNENMILQALRMAVARKKQALSQPVAQAQCST
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtatctctttgagaaggaatgcaatacgtgtttccttgatccatcgctttcatgcttt
ccctctccaacagtaagccagtcggactgctacgtgagcctgagcctcccaacagcttca
gtgcagcatttccgaaccaaaacggtcaagaacagcaagaacccaacatggaacgaaacc
ttccacttcacaattcagagccaggttaagaacattctggaactgaaagtttgtgatgag
gacaacataactgaagatgaccatctcctcactgtattctttgatgtctccaaaatccag
cttggagaaaacattcggctgtctttccagctgaatccacagggaaaagaggagctggag
gttgaattcacaatggagagcagtcctgatcctcctgaaaacattgttaccaatggagta
ttagtgtcccgcgaggttgcgtgtttggatgtgcaggtgaacggtgggaggctgaggaag
gattcttcagagagaaagtttgccttaactgtggacgggtcatatgaaggaaccaggact
cacacgctgagctcctgcctctgcccgacgtccccggccaggtttcactacatcaagtac
aaccagtcggcgctgactgtggctctgccgcgacggaggcggctcagcaggtctatatca
agtcaaaatgaaagtgatatgaacgagtccgtgactctagctctgaactcgcttcctata
caagagaaaataacaatagcggaggacaggacaattgacttgtacacaaaggcaagtgaa
tggacccagggtctgttttacaggccaagaaatctggatgcccgtctggggtttgagctg
tgccctgacgaacagaatttcctgcaaaaccggaggaaggtggttgctgctgcactgaaa
gatgttcttcatctggaggaagatctgcaagagcatgaggtgcctatagtggctgtgacc
acagcagggtgtgggataagagcactcactgccatgtatggcagcattttgggtcttcaa
aagttacgtgttctggattgcattacatacatcagtggctcatctggcacaacatggact
atgacaaaactgtatgaagatgctgactggtcacgtaaagatattggagaaataattatc
gaagctcggaagcaagcagccaagtgcaagatggggtctttttgcttgagaagtctgagg
aattattacagagagctgagccaaaggacccaagcaggacataagacatcttttattgat
ctgtgggggctcatgatcgaatccatgttaaatgatgggaaatgctaccacagactttct
gatcaacgtcgggcagtgaaccagggtcagaacccactgcccatctaccttgctctcaat
gtcaaggataaatttgccaccaaagattttagagagtgggtggaattcacgccgtatgag
gtgggcttcctgaagtacggcgccttcattcgcgcagaggattttggcagtgagttcttc
atgggtcgcctgatgaagaagctccctgaatcccggatctgcttcatgcaaggaatgtgg
agcagtatcttctccaaaaacctcttggatgcttggcatgcagctgacaattcagaggac
ttctggaacaggtggactcagaacaaagtgactgaaatagaggaacaaccggacttgcct
gagaagccccatgagatggctacatgcatgttcactcctacaagcggcctctccacggct
ctccgggacatcctgacggaccgccctgccgtctccaagtaccacaacttcctgaggggc
ttccagatgcacaacgagtacatccagcaggaacattttgcaaaatggaaagacacttta
ctggatacctctcctaatgacctgagagtcaactcagagcacctggagttggtggatgca
gctttcttctttgaaaccagttgcccgccccttatgagaccagagagaaatgtggatgtc
ataatacacttaaattacaccggtggatcacagaccttgcccctggagcaggcttgcaga
tacttctcagagcagggaattccattccctagtgttgggctgaaggatgatgagcagaac
ctgaaagagtgctacatgtttgatggtacagacaccccgggagctcctctgctgctttat
ttccctctagtgaatgacaccttccaaagatatgcagcacctggtattgcacgtagtgca
gccgaaattgaacagggcaaggttgatatctccggtttctgctctccatactcaacaagg
gaggtctcactgaaagcagaagatttcaacaagctccttaagctcactaattacaatatc
atgaacaatgagaacatgattcttcaggccttgcgcatggctgtggcacggaagaaacaa
gctctgagccagccagtagcacaagcacagtgctctacctga

DBGET integrated database retrieval system