KEGG   Columba livia (rock pigeon): 102084038Help
Entry
102084038         CDS       T02912                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00350  Tyrosine metabolism
clv00360  Phenylalanine metabolism
clv00380  Tryptophan metabolism
clv01100  Metabolic pathways
Module
clv_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
clv_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102084038
   00360 Phenylalanine metabolism
    102084038
   00380 Tryptophan metabolism
    102084038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102084038
Enzymes [BR:clv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102084038
    4.1.1.105  L-tryptophan decarboxylase
     102084038
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102084038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102084038
NCBI-ProteinID: XP_005507567
UniProt: A0A2I0MXK4
Position
Unknown
AA seq 500 aa AA seqDB search
MENARFSYTGIPMDAAEFRKSGKQMVDYIADYLEKIDKRQVFPDVEPGYLRPLIPDCAPQ
DPESFDDVFKDIEKIIMPGVTHWHSPYFFAYFPSTSSFPALLADMLCGGIGCVGFSWAAS
PACTELETVMMDWLGKMINLPEEFLAEKGGQGGGVIQGSASEATLISLLAARTKTIRRVQ
SEKPELTEADIMGRLVAYASDQAHSSVEKAALIGGVKIKKVSSDDKFSVCGSSLKKVLDE
DRASGLIPFFFCATLGTTPCCSFDKLFDLGPICNKKSFWMHIDAAYAGSAFICPEFRHLL
NGVEFADSFMFNPHKWLLVNFDCSAMWVKKRSDITSVFKLEPLYLQHQHQDSGLVTDYRH
WQIPLGRRFRSLKLWFVLRMYGVRGLQEHIRKHIRLSHQFEDLVLQDERFEICAEVVLGL
VCFRLKGSNELNKELLKSINEAKKIHLVPCHLREKFVLRFAICSRVVETTHVEFAWQHIS
QLATDLLKAWEQNHHQQHQQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgcaaggttttcctatactgggatacccatggatgctgcagagttccgcaag
agcgggaagcagatggtggactatattgcagattacctggagaagatagataaaagacag
gtcttcccagatgtggaaccaggatatctaaggcccctcattccagactgtgcaccccag
gatcctgagagctttgacgatgtctttaaagacattgagaagatcattatgccaggggtg
actcactggcacagtccctacttttttgcctacttcccctcaacctcttccttcccagct
cttcttgcagatatgttgtgtggaggaataggatgtgtgggcttctcttgggctgcaagt
ccagcttgcacagagctggagactgtcatgatggattggctagggaagatgattaatttg
cctgaagaatttttagctgagaagggtggccaaggtggaggagtcattcagggaagtgca
agcgaggccaccctgatttcactgcttgctgcaaggacaaaaaccatcagacgggtgcaa
tcggaaaagcctgagctaacagaagctgacatcatgggcaggctggtggcctatgcatct
gatcaggctcattcatcagtggaaaaggctgcattaattggtggtgtgaagattaaaaaa
gtttcttcagatgataaattcagtgtttgtggttcatccctaaagaaagttttggatgaa
gacagagcttcaggtcttatccctttctttttctgtgcaacacttggaaccacaccttgc
tgctcctttgacaaactgtttgacctgggtcctatttgcaataagaaaagtttttggatg
catattgatgcagcctatgctgggagtgcattcatctgccctgaattcaggcatcttcta
aatggagtagagtttgcagattcatttatgtttaatcctcacaaatggctcctagttaat
tttgactgctctgctatgtgggtgaaaaaaagatctgatataacaagtgtctttaaattg
gaacctctttacctgcagcatcagcatcaggactctggccttgtaacagattatcggcac
tggcaaatccccctgggcaggcggttccgctccctgaagctctggtttgtgctgaggatg
tacggggtcaggggactgcaggagcacatccgcaagcacatcaggctgtcacatcagttt
gaagatttagtccttcaggatgaaagatttgagatctgtgctgaggttgtcttgggacta
gtctgttttcggctaaagggctcaaatgaactaaataaggagcttcttaaaagcataaat
gaggccaagaagattcatctggtcccgtgccacctgcgagagaagtttgtgctacgtttt
gctatttgttcccgcgtcgtggaaaccacccatgtcgagtttgcctggcagcacatctca
cagctggcaactgatcttctgaaagcatgggagcaaaaccatcaccagcagcaccagcag
tga

DBGET integrated database retrieval system