KEGG   Columba livia (rock pigeon): 102084293Help
Entry
102084293         CDS       T02912                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00562  Inositol phosphate metabolism
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04070  Phosphatidylinositol signaling system
clv04140  Autophagy - animal
clv04150  mTOR signaling pathway
clv04210  Apoptosis
clv04218  Cellular senescence
clv04370  VEGF signaling pathway
clv04510  Focal adhesion
clv04620  Toll-like receptor signaling pathway
clv04625  C-type lectin receptor signaling pathway
clv04810  Regulation of actin cytoskeleton
clv04910  Insulin signaling pathway
clv04914  Progesterone-mediated oocyte maturation
clv04933  AGE-RAGE signaling pathway in diabetic complications
clv05164  Influenza A
Module
clv_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102084293 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102084293 (PIK3CA)
   04370 VEGF signaling pathway
    102084293 (PIK3CA)
   04068 FoxO signaling pathway
    102084293 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102084293 (PIK3CA)
   04150 mTOR signaling pathway
    102084293 (PIK3CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102084293 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    102084293 (PIK3CA)
   04218 Cellular senescence
    102084293 (PIK3CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102084293 (PIK3CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102084293 (PIK3CA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102084293 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102084293 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    102084293 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102084293 (PIK3CA)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102084293 (PIK3CA)
  Infectious diseases
   05164 Influenza A
    102084293 (PIK3CA)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102084293 (PIK3CA)
Membrane trafficking [BR:clv04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102084293 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF4135
Motif
Other DBs
NCBI-GeneID: 102084293
NCBI-ProteinID: XP_021148742
Position
Unknown
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLTIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVELRDANAPHSRALYVCPPNVESSSELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYNQLPLD
TFTMPSYSRRISTATPYMNGEATAKSLWTINSALRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLLYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTDTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMTVIEEHANWTISRELGFNYSCAGLSNRIARDNELRESDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLRDKNKGEMYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLXXXXXXXXXXXXXX
XIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgcgaccatcatctggtgaactatggggcatccacttgatgccaccgcggatc
cttgtggagtgtcttctcccaaatggaatgatagtgactctagaatgcctccgtgaggcc
accttactaacaattaaacatgaactttttaaagaagcaagaaaataccctctctatcag
ctccttcaagatgaatcttcttacatttttgtaagtgtcacacaagaagcagaaagagaa
gaattttttgacgaaacacggagactttgtgacctgcgactgtttcagccttttctaaaa
gtcatcgaaccagtaggtaacagagaagaaaagattcttaatagagaaataggttttgct
ataggcatgcctgtctgtgaatttgacatggtaaaggatccagaagtacaagacttcaga
agaaatattcttaatgtttgtaaagaagctgtggaacttcgagatgccaatgcaccacac
agtagagcattatatgtctgtcctccaaatgtagagtcttcatctgagctacccaaacac
atatacaataaactagataaagggcaaattatagtggtgatatgggtaatagtctcacca
aacaatgataagcagaaatacaccttaaaaatcaatcatgactgtgtgcctgagcaagtg
atcgctgaagcaattaggaagaaaacacgaagcatgttactgtcgtccgaacaactgaaa
ctttgcgtcttggagtaccagggcaaatatattttaaaagtgtgtggctgcgatgaatac
ttgctagaaaagtatccactgagccagtataagtatataagaagctgtataatgcttggt
cgcatgcccaatctgatgctgatggctaaggaaagcctgtataaccagctgccactggac
acctttacaatgccatcttactccaggcgtatctctacagctacaccctacatgaacgga
gaagctacagccaaatccctctggactataaatagtgctctcagaataagaatcctctgt
gcaacctatgtaaatgtaaacattagagacattgacaagatctacgttagaacaggtatc
taccatggaggagaacctttgtgtgacaatgtgaatactcaaagggtaccctgttctaat
cccagatggaatgagtggctactgtatgacatgtacattcccgatcttccacgtgctgct
cggctctgcctttctatctgttctgttaaaggccggaagggtgccaaagaggagcactgt
ccattggcttggggaaatataaacatgtttgattacacagacacccttgtttctgggaaa
atggctttgaacctttgggcggtacctcatgggctggaggatttgttgaatcctattggt
gttactggatcaaacccaaataaggaaactccatgtttagagctggaattcgattggttt
agcaatcctgtaaagttcccagatatgacggtgatcgaagaacatgccaattggactata
tcacgtgaactgggctttaactacagctgtgcggggctgagcaacagaatagctcgagat
aacgaattaagggaaagtgacaaggagcaactgcgagccatctgtacacgggatcctttg
tctgaaatcactgagcaagagaaggacttcctctggagccacagacactattgtgtgaat
actccagaaattctgcccaaattacttttgtctgttaaatggaattctagagatgaagtg
gcccagatgtactgtttggtaaaagattggcctccaatcaagccagagcaagcaatggag
cttttggactgtaattatccagatccaatggtgcgagcttttgcagttcggtgtctagag
aagtacttgacagacgacaaactgtctcagtatttaatccagctagtacaggttctgaaa
tatgaacagtatttagataatcagcttgtgagatttttactcaagaaggcactgaccaat
caaaggataggacacttcttcttttggcatttaaagtctgaaatgcacaataaaactgta
agtcagaggtttggtttacttctggagtcctattgtcgagcgtgtggaatgtacctaaag
catctgagcaggcaggtggaggctatggagaaattgattaacctcacagatattctcaaa
caggaaaaaaaagatgagacccagaaggtacagatgaagtttcttgttgaacaaatgaga
cggccagattttatggatgctttacaaggttttatctctcctcttaatcctgcgcatcaa
ctgggaaatcttcggcttgaggagtgcaggataatgtcatctgcaaaaaggcccttgtgg
ttgaactgggaaaacccagatattatgtctgaattgttatttcagaacaatgagatcata
tttaaaaatggagatgacttgcgtcaggacatgttgacacttcagataatcagaattatg
gaaaacatctggcaaaatcagggtcttgatcttcggatgttgccttatggatgtttgtct
atcggtgactgcgtgggactcatcgaagtggtgaggagctctcataccatcatgcagatt
cagtgtaaaggaggcttaaaaggagcattgcagttcaacagccatacattgcatcagtgg
ctcagggacaagaacaaaggagaaatgtatgatgcagctattgacttgtttacacgttct
tgtgctggctactgtgttgctacctttatactgggcattggtgaccgtcacaatagtaac
atcatggtaaaagatgatggacaactgtttcacattgactttgggcacttccttgatcac
aagaagaaaaaatttggttataaaagagaacgtgtgccatttgtcttaacacaagacttt
ttaatagtgattagtaaaggagcccaagaatgtaccaaaacaagggagtttgaaaggttt
caggagatgtgttataaggcgtatctagcaattcggcagcatgccaatctcttcataaat
cttttctccatgatgctnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nacattcgaaagacccttgcgttggacaaaacagagcaggaagctcttgagtacttcatg
aaacagatgaatgatgctcaccatggtggctggacaacaaaaatggactggatcttccac
acaataaagcaacatgctttgaactga

DBGET integrated database retrieval system