KEGG   Columba livia (rock pigeon): 102085947Help
Entry
102085947         CDS       T02912                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04218  Cellular senescence
clv04370  VEGF signaling pathway
clv04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102085947 (MAPKAPK2)
   04370 VEGF signaling pathway
    102085947 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102085947 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102085947 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102085947 (MAPKAPK2)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102085947 (MAPKAPK2)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102085947 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 102085947
NCBI-ProteinID: XP_021153969
Position
Unknown
AA seq 320 aa AA seqDB search
MSPSVLCFGLCLQMLQDCPKARREVELHWRASQCAHIVRIMDVYENLYQGRKCLLIVMEC
LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPN
AVLKLTDFGFAKETTTHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGY
PPFYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEVKQLIRNLLKTDPTQRMTITEFM
NHPWIMQSMQVPQTPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDSSN
PLLMKRRKKANPTEPAALPH
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttcagtgctttgctttggactctgcttgcagatgctgcaggactgcccgaag
gcccgcagggaagtggagctgcactggagggcatcgcaatgtgcgcacatcgtccgcatc
atggatgtctacgagaacctctaccaggggaggaagtgtctgctcatcgtcatggagtgc
ttggacggtggagagctcttcagccgaattcaagacaggggagaccaagccttcacagaa
cgggaggcttcagagataatgaagagcattggggaagccatccagtacctacactctatc
aacatcgcgcaccgggatgtgaagcctgaaaacctcttgtacacctctaaacggcccaac
gctgtgctaaaactcacggactttggctttgctaaagaaaccaccacgcacaactccttg
gccaccccatgctacacgccgtactacgtggccccggaggttcttggcccggagaagtac
gacaagtcctgtgatatgtggtcactcggagtcatcatgtacattctgttatgcgggtac
ccccctttctactccaaccacggcctggccatctcacctggtatgaagaagagaatccga
atgggccagtatgagtttcccaatcctgaatggtccgaggtgtcggaggaagttaagcag
ctgatccgtaacctgctgaagacggacccaacccagcgcatgacgataacggagtttatg
aaccacccctggatcatgcaatccatgcaggtgccccagaccccgctgcacaccagccgt
gtgctgaaagaggagaaggatctatgggaagacgtgaaggaggagatgacgagcgcgctg
gccaccatgcgagtggactacgaacaaatcaagatcaagaagatcgaagattcctcgaac
cctttgctgatgaagaggcggaagaaagcgaatcccactgaacccgctgcgctgccacac
tga

DBGET integrated database retrieval system