KEGG   Columba livia (rock pigeon): 102086471Help
Entry
102086471         CDS       T02912                                 

Gene name
TNKS2
Definition
(RefSeq) tankyrase-2
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102086471 (TNKS2)
   03036 Chromosome and associated proteins [BR:clv03036]
    102086471 (TNKS2)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102086471 (TNKS2)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102086471 (TNKS2)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     102086471 (TNKS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank Ank_4 Ank_2 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 102086471
NCBI-ProteinID: XP_005503063
Position
Unknown
AA seq 1102 aa AA seqDB search
LPGFGRKDVVEYLLQSGANVHARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWN
YTPLHEAAIKGKTDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLES
ARTGNEEKMMSLLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGD
LVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPT
LLNCHNKSTIDLAPTPQLKERLAYEFKGHSLLQAARESDVARIKKHLSLETVNFKHPQTH
ETALHCAAASPYPKRKQVCELLLRKGANINEKTKDFLTPLHVASEKAHNDVVEVVVKHEA
KVNALDNLGQTSLHRAAYCGHLQTCRLLLSSGCDPSIVSLQGFTALQMGTESVQQLLQEG
IPLGNSDADRQLLEAAKAGDVDTVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEY
LLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGK
YEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKL
CSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGH
VDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL
VTADDVSALLTAAMPPSALPTCYKPQVISVSQTTASTADSLSSVPSSPSSLSAASSLDNL
SGSFSELPSVVGTNSAEGATVLEKKEVSGVDFSINQFVRNLGLEHLIDIFEREQITLDVL
VEMGHKELKEIGINAYGHRHKIIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSTEDKE
FQSVEEEMQSTVREHRDGGHAGGVFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHA
NERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPIH
KDRSCYVCHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRG
EQAYPEYLITYQIMKPEATTEA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
cttccagggtttggtcggaaggatgtcgttgaatatttacttcaaagtggtgccaatgtc
cacgcacgagatgatggaggccttattcctcttcacaatgcttgctcttttggtcatgcc
gaagttgtcaatcttctgttgcggcatggtgcagatcctaatgctcgggataattggaat
tacactccccttcatgaagctgccattaagggcaagacagatgtctgcattgtactgctg
cagcatggcgctgaaccaaccatccggaacacagatggaagaacagctttggatttagca
gatccgtctgcgaaagcagtgctgactggtgaatacaagaaagatgagctcttagaaagc
gccaggactggaaatgaagaaaagatgatgtctcttcttacaccgttaaacgttaactgt
catgcaagtgatggcagaaagtctactcctttacatttagcggctgggtataaccgtgta
aaaatagtacagctcttactgcaacatggggctgatgtacatgctaaggataaaggagat
ttggtgccacttcacaatgcctgttcctatggtcattatgaagtaacagagcttctagta
aagcatggagcatgtgtcaatgcgatggatctgtggcagttcacccctctgcatgaagca
gcttctaagaacagggtggaagtgtgttctcttttgttaagttatggtgctgacccaaca
ctgttgaactgtcacaacaagagcaccattgatttggctccaacacctcagttaaaagaa
cgattagcatatgaattcaaaggtcactcactgctacaggctgcaagagaatcagatgta
gctcgtataaagaaacatctttctttggagacagtgaacttcaaacatcctcaaacacat
gagacagcactgcactgtgctgccgcatctccataccctaagagaaaacaagtatgcgaa
ttgctgctgaggaaaggagccaacatcaatgaaaaaacaaaagacttcttgactcctctg
catgtggcatcagaaaaggctcataatgatgttgtcgaagtggttgtgaaacatgaagct
aaggttaatgcattagataatcttggccagacctctcttcatagagcagcatattgtggt
catcttcagacctgcaggttgctgttgagttctggatgtgatccttccattgtgtctctg
cagggctttacagccttacaaatggggactgaaagtgtgcaacagctactacaagaaggt
atcccattaggtaattctgatgcagatcgacagttgctggaggctgcaaaggctggagat
gtggatactgtaaaaaaactttgtacagttcaaagcgtgaactgcagagatattgaagga
cgtcagtctacaccacttcattttgcagctggatataatagggtgtctgttgttgaatat
cttctccagcatggagctgatgtgcatgcgaaagataagggaggtcttgttcctttacat
aacgcttgctcatatggtcactatgaagttgcagaattgctggttaaacacggtgcagtt
gtcaatgtagctgacttgtggaaattcactcccttgcatgaagctgcagcgaaaggaaaa
tacgagatttgcaaactcctgttacagcatggagctgaccctacaaagaaaaacagagat
ggaaatactcctctagaccttgttaaagatggcgatactgatattcaagacctactgaga
ggagatgcagctctgctagatgctgcaaagaaaggttgtttggcccgagtgaaaaagctg
tgttcacctgacaatgtcaactgtcgggacacacaaggacggcattcaacaccactacat
ttagcagctggttacaacaatttggaggttgcagaatacctgttacaacatggagcagat
gtgaatgcacaggataaaggaggtttgattcctctgcataatgcagcatcttatgggcat
gttgatgtagcagctttacttataaagtataatgcatgtgtgaatgctacagacaaatgg
gctttcacacccctgcatgaagcagcgcagaaaggaaggacacagctctgtgccttgtta
ctggcgcatggggctgatcctactctgaaaaaccaagaaggacaaacaccattggacctt
gtcactgcagatgatgtcagtgcattattgacagcggcaatgcctccttccgccttacca
acttgctacaaacctcaggtgataagcgtgtctcagactacggcttctacagctgattct
ctgtcatctgttccatccagtccatccagtctgtctgctgcaagtagtcttgacaacttg
tctggcagtttttctgaacttccttctgttgttggtacaaacagtgcagagggagctact
gtgctggagaaaaaagaagtttcgggtgtagattttagcataaatcagtttgtgcggaac
cttggccttgaacatctgattgacatatttgagagagaacagataacattggatgtattg
gtggaaatggggcacaaagaactgaaggaaatcggaattaatgcttatggtcataggcat
aaaatcattaaaggagttgaaagacttatttctggacagcaaggacttaatccatacctg
actctaaatacttctggtagtggaactattctcatagatctttccactgaagataaggaa
tttcagtcagtagaagaagagatgcagagtacggtccgagagcacagagatggaggacat
gctggtggggtcttcaacagatacaacatcttaaagattcagaaagtgtgcaacaaaaaa
ctatgggaaagatacacccacagaaggaaagaggtctctgaagagaatcataaccatgct
aatgaaaggatgctgtttcatggctcgccatttgtaaacgcgatcattcacaaaggcttt
gatgagagacacgcatatataggcggcatgtttggagctgggatttattttgctgaaaat
tcttccaaaagcaatcagtatgtgtatggaatcggaggtggcactggatgtccaatacac
aaagaccggtcttgttatgtttgccacaggcagttgctgttttgccgtgtaacactgggc
aagtctttcctgcagttcagtgctatgaaaatggctcattctcccccaggacatcactca
gttactggacgacccagtgtaaatggattggcattggcagaatatgtcatttacagaggg
gagcaggcttatccagaatacttgattacctaccagattatgaaacctgaagccaccact
gaagcttaa

DBGET integrated database retrieval system