KEGG   Columba livia (rock pigeon): 102086540Help
Entry
102086540         CDS       T02912                                 

Gene name
PHOSPHO1
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphoethanolamine/phosphocholine phosphatase
  KO
K06124  phosphoethanolamine/phosphocholine phosphatase [EC:3.1.3.75]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00564  Glycerophospholipid metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102086540 (PHOSPHO1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102086540 (PHOSPHO1)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.75  phosphoethanolamine/phosphocholine phosphatase
     102086540 (PHOSPHO1)
Protein phosphatases and associated proteins [BR:clv01009]
 HAD phosphatases
  Other HAD phosphatases
   102086540 (PHOSPHO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Put_Phosphatase HAD
Motif
Other DBs
NCBI-GeneID: 102086540
NCBI-ProteinID: XP_021151258
Position
Unknown
AA seq 260 aa AA seqDB search
MRRCCGGAGLPCLFKGVGMASPRPPKYLLVFDFDETIVNENSDESVVRAAPGQALPERIR
QTXYYNEYMQRVLGYLGDQGVRMGDFKAVYESIPLSPGMPDLFQFLSKNHELFEIILISD
ANMFGIECSLXXXXXXXXXXXXXXXXXGYLSLGPYHSHKCLDCPANMCKRKILTEYLAER
AQEDVEFQRVFYVGDGANDFCPAAALTAADVAFPRKGFPMHRLAQELQHKQPGAFQATLV
PWDSATEIARYLQELLKKKG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggtgctgcgggggcgcggggctgccatgcctgtttaagggtgtggggatggcc
agcccccggcctcccaaatacctcctggtctttgattttgacgagaccatcgtcaacgag
aacagcgacgagtcggtggtgcgggcggcgccggggcaggcgctgccggagcggatccgc
cagacannatactacaacgagtacatgcagcgcgtgctgggctacctgggcgaccagggc
gtcaggatgggcgacttcaaggccgtctatgagagcatcccgctgtcccccggcatgccc
gacctcttccagttcctctccaagaaccacgagctctttgagatcatcctcatctccgac
gccaacatgtttgggatcgagtgcagcctgnncnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnngggctacctctccctggggccctaccacagccacaagtgc
cttgactgcccggccaacatgtgcaaacgcaaaatcctcaccgagtacctggccgagcgg
gcccaggaggacgtggagttccagcgggtgttctacgtgggcgacggcgccaacgacttc
tgccccgcggcggcgctgacggcggcggacgtggcgttcccgcggaagggcttccccatg
caccgcctggcccaggagctgcagcacaagcagccgggcgcgttccaggccacgctggtc
ccctgggactcggccactgagatcgcccggtacctgcaggagctgctcaagaagaagggc
tga

DBGET integrated database retrieval system