KEGG   Columba livia (rock pigeon): 102086788Help
Entry
102086788         CDS       T02912                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00561  Glycerolipid metabolism
clv01100  Metabolic pathways
Module
clv_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102086788 (MGLL)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102086788 (MGLL)
Peptidases [BR:clv01002]
 Serine Peptidases
  Family S33
   102086788 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Thioesterase PGAP1 Abhydrolase_5 DUF1350 LIDHydrolase Ser_hydrolase Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 102086788
NCBI-ProteinID: XP_005507580
Position
Unknown
AA seq 299 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQHLFCRYWKPAATPRALVFIAHGAG
EHCGRYDDLAQRLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFVRDSLQHIDLMKKEHP
ELPVLILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLP
NLSLGSIDPSAISRNKKEIESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLLFF
LMHILVFSVLSLLSPWLQVYEEACHALHKELPEVSTSVFTEILTWIGQKVPAAGETSRA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcttccagaatgccagaggaaagttcgcccaagcggagtcctcaa
aacatcccgtacaaggacctgccccatatcatcaatgctgacgggcagcatctcttctgc
aggtattggaagccagcagcaactcccagggccctggtgtttatcgctcatggcgctggg
gaacactgcggccgctacgatgacttggcccagaggctcacaggacttaacttgtttgtc
tttgcccatgaccatgttggccatggccagagcgagggtgatcgcatggttgtctccgat
ttccacgtcttcgtcagggacagtttgcagcacatcgatctcatgaagaaggagcacccc
gagctgcccgttctcattctggggcactccatggggggagccatctccattctgacagcc
agtgagagacccagtgagttttcaggcatgctgttaatctctcctttagtggtagccagc
ccagaagtcgccactcccatcaaggtttttgcagcgaaagtgctcaactttgtcctccca
aacctgtcgctgggatcgatagacccaagtgcaatttcccggaacaagaaggagatagag
tcttatacatctgatcccttggtctaccacggtggcatgaaggtctccttcgtcatccag
ctgatgaatgccattgccagaattgagcgagctctgcccaagctgactttgctgtttttt
ttaatgcatattttggttttttctgtgctatctctgctctctccctggttgcaggtgtac
gaggaagcctgtcatgccctccacaaagagctgcccgaggtctctacctctgtcttcaca
gaaatactgacatggatcggccagaaggtcccagcagctggggaaaccagccgtgcttaa

DBGET integrated database retrieval system