KEGG   Columba livia (rock pigeon): 102086952Help
Entry
102086952         CDS       T02912                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00500  Starch and sucrose metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102086952
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102086952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 102086952
NCBI-ProteinID: XP_021149199
Position
Unknown
AA seq 512 aa AA seqDB search
MQVLLLLAAVGVCWGQYNPNVQAGTTSIVHLFEWRWADIALECERYLAPYGFGGVQVSPP
NENIVITSPYRPWWERYQPISYKICTRSGNEDEFRDMVSRCNNVGVRIYVDAVVNHMCGS
AGGSGTHSTCGSYFNAGSEDFPAVPYSGWDFNDGKCHTGNGEIQNYGDIYQVRDCRLSGL
LDLALEKDYVRTKIADYMNHLIDIGVAGFRIDAAKHMWPGDIKAFLDKLNNLNTRWFSEG
TRPFIFQEVIDLGGEPITSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKLSYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RSFVNGQDVNDWIGPPSYSDGTTKPVTINADTTCGNDWVCEHRWHEIRNMVVFRNVVDGQ
PFSNWWDNGSNQVAFGRGSKGFIVFNNDDWHLNTDLQTGLPAGTYCDVISGDKEGNRCTG
TQVYVSGDGMANFQISNSAEDPFIAIHVGAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccttctgctgctcgcagctgtgggggtgtgctggggtcagtacaaccccaac
gttcaggccgggacgacatctatcgtacatctctttgaatggcgctgggccgacattgct
cttgagtgtgaacgctatttagctccttatggatttggaggagttcaggtttctcctcca
aatgaaaatattgtcattactagcccttacagaccctggtgggaaagataccagcccatc
agctacaagatctgtacccgatcgggaaacgaagatgaattcagggacatggtgagcaga
tgcaacaacgttggggttcgtatttatgtggatgctgttgtcaaccacatgtgtgggtct
gcaggtggctcaggcacccattccacctgtgggagctattttaatgctgggagtgaagat
tttccagctgtgccgtactcaggctgggatttcaatgatggcaaatgtcacactggaaat
ggagaaattcagaattacggtgatatatatcaggttcgggactgtcgcttgtctggcctt
cttgatctggccctggagaaggactatgtgcgcacaaaaattgccgattacatgaaccat
ctcatcgatattggtgtagcaggcttccgaattgatgctgccaagcatatgtggcctggg
gacataaaagcatttctggacaagctgaacaatctaaatactagatggttttctgaagga
acgagacctttcattttccaggaggtaattgacttgggcggagagccgatcacaagcagt
gagtactttggaaatggccgagtgacagagttcaaatacggtgcaaaactggggacagtg
atccgcaagtggaacggagaaaagctgtcctacttaaagaactggggagaaggctggggc
tttgtgccttctgacagagccctggtctttgtggataatcacgacaaccagcgtgggcac
ggcgccggcggagcttccattctaaccttctgggatgccaggctttataaaatggcagtt
ggtttcatgcttgctcatccgtatgggttcacccgtgtgatgtcaagttatcgctggcca
agatcttttgtaaatggacaggacgtcaatgactggattggacccccaagctactcagat
ggaaccacgaagcctgttacgatcaatgcagacactacctgtggcaacgactgggtttgt
gaacatcgctggcatgaaataaggaacatggttgtcttccgtaatgtggtggacggtcag
cctttctccaactggtgggacaacggcagcaatcaagtagcttttggccgtggtagtaaa
ggcttcatcgttttcaacaatgatgactggcatctgaacaccgatttgcaaactggcctg
cctgctggtacctactgtgatgttatttctggagacaaagagggcaacagatgtactgga
acacaggtgtacgtttctggtgatgggatggctaatttccagattagcaacagtgctgaa
gatccattcattgcaattcacgttggtgccaagttataa

DBGET integrated database retrieval system