KEGG   Columba livia (rock pigeon): 102088293
Entry
102088293         CDS       T02912                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102088293 (RDH5)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102088293 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 DUF2115
Other DBs
NCBI-GeneID: 102088293
NCBI-ProteinID: XP_005515392
UniProt: R7VUB5
Position
Unknown
AA seq 219 aa
MSPSGLFGLVNNAGVANPIGPTEWMSPEDYRGVMAVNAFGVIEVTLAFLPLLKRARGRVV
NTSSVLGRLSANGGGYCISKYCIEAFSDSLRRDMYHFGVKVSIVEPGFFKTAVTNLESIE
GSLRQLWERLPPETRRSYGEEFFQQYLKVQRLIMNFICDGDLCKVTSCMEHALGARHPRT
RYSAGWDAKLLWLPASYLPACLVDLALAIILPKPAQRVR
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtcgccttcaggcctcttcgggctggtgaacaatgcgggggtcgccaaccccatcggc
cccacggagtggatgtcccccgaggactaccggggggtgatggctgtcaatgccttcggc
gtcatcgaggtgacgctggcgttcctgccgctgctcaagcgggcgcgtggccgcgtggtc
aacacctccagtgtcctcggtcgcctctcagccaatggtggtggctactgcatctccaaa
tattgcattgaggccttttctgacagcctgcggagggacatgtaccactttggtgtcaag
gtcagcatcgtggagcctgggttcttcaagacggccgtgaccaacctggagagcattgag
gggtccctgcggcagctctgggagcgcctgccccctgaaacgcggcgcagctacggcgag
gagttcttccagcagtacctcaaggtgcagcggctgatcatgaacttcatctgcgacggg
gacctgtgcaaggtgacgagctgcatggagcacgcgctgggggcgcggcacccccgcacc
cgctacagcgccggctgggacgccaaactgctttggctgcccgcgtcctacctacctgcc
tgcctggtggacctggcgctggccatcatcctgcccaagccggcccaacgcgtccgctag

DBGET integrated database retrieval system