KEGG   Columba livia (rock pigeon): 102088307Help
Entry
102088307         CDS       T02912                                 

Gene name
ZW10
Definition
(RefSeq) centromere/kinetochore protein zw10 homolog
  KO
K11578  protein transport protein DSL1/ZW10
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102088307 (ZW10)
   03036 Chromosome and associated proteins [BR:clv03036]
    102088307 (ZW10)
Membrane trafficking [BR:clv04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   NRZ (DSL1) complex
    102088307 (ZW10)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     RZZ complex
      102088307 (ZW10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zw10 BAR_3 Reovirus_M2
Motif
Other DBs
NCBI-GeneID: 102088307
NCBI-ProteinID: XP_013227563
UniProt: A0A2I0LQY5
Position
Unknown
AA seq 767 aa AA seqDB search
GAGSGLLCCTAGKVCRRSPSKRRISLVNRRKVWQRWGHPDCRRKGNPNGTCARSVEPVRR
CKQLPCAGQQVQRDPNAAVAELAELKQQLERDTLVLSVLKKLQEFDTAMEEYNTALLEKK
YVVAAQQLEKTRSNLKMLESRKGFELKILKALRTELTVQTENMLYHLGEEWQKLVVWKLP
PSKESSSLESAMHSELHLHTVPSKEETAGPPVASVLQAFAVLGELHAKFKSFGQLLLKYI
LKPLISYPSLQPFTEEQSDVFILRFKSQEPHLDYSSPIEVFDKIKLIFEVLHKYLLNVPL
EQPTEDTKDCRVILPELLGDVIWEDLSDCLIQNCLVNSIPTNSSKLEQYIEVIKSAEEFE
KALKNMQILKGDMTDLLKYARNVNSHFANKKCQAVIVAARNLMTSEIHNTVKITPDSGVA
LPRLPDPGSGDHLKTQKTNKLPHNNVVNLENDTKLTQYMFSLPTCRISSSVEELMKLAYQ
TLLEATASTDQCCIQLFYSVRNIFQLFCDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHL
LTLGHQFRYRLTDILCDGAATFVDLVPGFRRLGTACFLAQMRVQKGEILERLSSARNFSN
MDDEENYSAANKAIRQVLHQLKRLGKVWQDVLPVTVYCKAMGTLLNTALTEIIARIAALE
DISAEDADRLYSLCRIMVEEGPRVFTPLPEEDKNKKYQEEVPVYVKKWMTFKELMIILQA
NLQEIVDQWADGKGPLAAEFSAAEVKSLIRALFQNTERRAAALAKIK
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
ggggctggctcgggtttgctctgttgtacggctggaaaagtgtgtcgcaggtctccttcc
aaaagaaggatcagcctcgtaaatcgcagaaaggtgtggcagcgctggggccaccctgat
tgcaggcggaaagggaacccgaatgggacctgcgcgcgttccgtggagcctgtaaggaga
tgcaagcagctcccgtgcgctggacagcaggttcagcgagacccaaatgccgctgttgcc
gaattggctgaattgaagcagcagttggagcgagacacactggttctgagcgttctgaaa
aagctacaggagtttgatacagctatggaagagtacaatactgctttgctggaaaagaag
tacgttgtagcagctcaacaactggaaaagacaagaagcaacctgaaaatgctggaatcc
cgcaagggctttgagctgaagatcctgaaagcgctgcgcacggagctcacagtgcagacc
gagaacatgctctatcatttaggagaagaatggcagaaactggttgtatggaagcttcct
ccttcgaaagaaagcagcagcctggagtcagcgatgcattcagaactgcacttacacact
gtgccatcaaaagaggagactgctggccccccggttgcgtctgtgctgcaggcgtttgct
gtcctaggagaactgcacgccaaatttaaaagttttggtcagttgttgctgaaatacatc
ctcaagcccctgatttcatacccatctcttcagccattcacagaggaacagtcagatgtg
ttcatcctgcgttttaagtcccaggagcctcacttggattattcctctcctatagaggtt
tttgacaagatcaagcttatttttgaagttcttcacaagtatttgctgaatgtgcctctt
gagcagcctacggaagatacaaaggattgcagggttatactcccggaactgctgggtgat
gtgatatgggaagatttatcagactgcctaattcagaactgcctggtgaattcaatccca
accaacagcagcaaactggagcagtatatagaggtgataaaatccgcagaggaatttgaa
aaagccctgaagaacatgcagattttgaaaggagacatgaccgatttactgaaatacgcc
cgtaatgtcaattcccactttgctaacaagaagtgccaggctgtgattgtggcagccaga
aacctgatgacctcagaaatacacaatactgtaaagatcacacctgattccggtgtagcc
cttccaaggcttcctgatcctgggtcaggagatcacttaaaaacgcaaaaaactaataaa
cttccgcataacaacgtggtgaatttggagaacgacactaaactgacccagtacatgttt
tctctacccacctgccgcatcagttcatcggtggaggagctgatgaagctggcgtatcag
acgctgctggaggccacagccagcacggatcagtgctgtatacagctcttctactctgtg
cggaacatattccagctgttctgtgatgtagtgccaacttaccacaaagagaaccttcag
aaactaccccagctggcggccattcaccacaacaactgcatgtacatcgcgcaccacttg
ctcaccctggggcaccagttccgataccgcctgactgacatcctgtgcgacggagcagcc
acctttgtagatctggtacctggcttcaggagacttgggacagcgtgttttctggcccag
atgcgagtacagaaaggagaaatcctagagaggctgtcaagtgccaggaatttttctaat
atggatgatgaagaaaattattctgcagcaaacaaagcaataaggcaggtgctgcatcag
ctgaaacgactgggaaaggtctggcaagacgtccttcccgtgactgtttactgcaaggct
atggggactctgctgaacacggctctcacggagatcatcgctaggattgctgccctggag
gatatctctgcggaagatgcagatcggttgtactccctctgcaggatcatggtggaggaa
ggaccccgagttttcaccccactacctgaagaagacaaaaataagaaataccaagaggaa
gttccagtctacgtgaagaagtggatgacgttcaaagagctgatgatcatcttgcaagcc
aacctccaagaaatcgtagatcagtgggcggatgggaaggggcctcttgcagctgaattc
tctgcagctgaagtgaagagcctgatccgagccttgttccagaacacggaaaggagagca
gcggcactggccaaaattaagtaa

DBGET integrated database retrieval system