KEGG   Columba livia (rock pigeon): 102088996Help
Entry
102088996         CDS       T02912                                 

Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102088996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:clv04030]
    102088996
G protein-coupled receptors [BR:clv04030]
 Rhodopsin family
  Lipid
   Leukotriene
    102088996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 102088996
NCBI-ProteinID: XP_005507171
UniProt: A0A2I0M7V8
Position
Unknown
AA seq 336 aa AA seqDB search
MSQAEDSSIHSMWNIMRSVVCTILSLSFIIGTPGNCIVIWTVCTKMKQVSPSVLLILNLA
IADVLVLITLPIWIYSFVDSWVFGVIFCKILVFIIYCSMYASIFLITALSLERLMAVFYP
FTIQRYKTKEKISLIIFLIWFLSIAFGISVIPFQETEKMNGGLLCTCRNYSSQRQRLSYL
LLETLAGFVIPFLIICTCYMCVARRISRMTYQSRQRSERLVASVVVAFILCWFPHHLFNI
LDIISIQIELSNREMSLALEEIVDRGVYISGALAFISSCINPLLYAFAARRFQNHLRFAK
ISKLFEQMSQTVTEEDKKRSMVVTKQEDTLVSTENL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggctgaggacagcagtatccactcgatgtggaatatcatgaggtcagtagtc
tgcacgatactgagcttgtcatttattattgggacccctggaaattgcattgtcatctgg
actgtttgtacaaaaatgaagcaagtatctccttccgtcctgctgatcttgaacctggcc
attgccgatgtccttgtactgattactttaccgatctggatttactcctttgttgactca
tgggtttttggagtaatcttctgcaaaatactggttttcatcatttactgcagcatgtat
gctagtatatttctgatcacagcactgagcttggagcggttaatggctgtgttttaccct
ttcacgattcaaagatacaaaactaaagaaaagatttctttaatcattttcctcatttgg
ttcctgtctattgctttcggcatttctgtcattccatttcaagagacagaaaaaatgaac
ggtggactactatgtacgtgtcgcaactactcttcgcaaagacagagactgtcgtatctt
ttgctggagactcttgcaggttttgtaatcccttttttaattatttgcacttgttacatg
tgtgttgcaagaagaataagcagaatgacttaccaatccaggcagcgatcggaacggctc
gttgccagcgttgtggtggcattcattttatgctggttccctcatcatctctttaacatc
ctcgatattatttcaattcagatagaactctctaacagggaaatgtctttggctctggaa
gaaattgtagacagaggagtgtacatctctggagcactggcattcatcagcagctgtatt
aaccctctactttacgcttttgctgcacggagatttcagaatcacctgagatttgccaag
atatcaaagctgtttgaacagatgagtcagactgtaacagaggaggacaagaaaagaagt
atggttgtaaccaaacaagaagatactttagtaagcacagaaaatctctaa

DBGET integrated database retrieval system