KEGG   Columba livia (rock pigeon): 102089078Help
Entry
102089078         CDS       T02912                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00564  Glycerophospholipid metabolism
clv00565  Ether lipid metabolism
clv00590  Arachidonic acid metabolism
clv00591  Linoleic acid metabolism
clv00592  alpha-Linolenic acid metabolism
clv01100  Metabolic pathways
clv04010  MAPK signaling pathway
clv04217  Necroptosis
clv04270  Vascular smooth muscle contraction
clv04370  VEGF signaling pathway
clv04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102089078 (PLA2G4A)
   00565 Ether lipid metabolism
    102089078 (PLA2G4A)
   00590 Arachidonic acid metabolism
    102089078 (PLA2G4A)
   00591 Linoleic acid metabolism
    102089078 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    102089078 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102089078 (PLA2G4A)
   04370 VEGF signaling pathway
    102089078 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102089078 (PLA2G4A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102089078 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102089078 (PLA2G4A)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102089078 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 DUF2281
Motif
Other DBs
NCBI-GeneID: 102089078
NCBI-ProteinID: XP_005511976
UniProt: A0A2I0LRH7
Position
Unknown
AA seq 749 aa AA seqDB search
MSIIDPYQHIVVEHQYSHIFTVTVRKATNVTKGAFGDMLDTPDPYVELFIPSAPDCRKRT
KHFNNDVNPVWDETFEFILDPNQDNILEVTLMDANYVMDETLGTSTFPISSLKLGEKKEV
QLTFNDVTEMTLELSLELFNXXXXXXXXXXXDEEKKFRQQRKENIMHSMKSFLGEENSKN
LTSSRDVPVIAVLGSGGGFRAMVGFAGVMKALYESGVLDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPKEINQELMNSVSHNPLLLLTPQKVKRYIEALWNKKSSGQPVTFTDIFGMLIG
ETLIHNRMDTTLSDMKEKINHAQCALPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMSPDLFGSKFFMGTVVKKYNENPLHFLMGVWGSAFSILFNRVLGVSNSQNKGPTMEEE
LENIRLKHLVSNDSSDSEDESQHPKGTENTEANQEYQNSSQESWVQRMLMALVGDSALFN
TREGRAGKVHNFMLGLNLNSCYPLSPLADLLSQESVEEDELDAAVADPDEFERIYEPLDV
KSKKIHIVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKEILLAEKWAKMN
KLPFPKIDPNVFDREGLKECYVFKPKDTSSEKDCPTIIHFVLANINFRKYKAPGVPRETQ
EEKDFADFDIFDDPNTPFSTFNFQYPNEAFKRLHDLMEFNTLNNIDVIKQAMMESIEYRK
ENPSRCSVSLSSVEARRFFNKTNLNNNLT
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcatagatccctatcaacacattgtggtggaacaccagtattcacacatattc
actgtgacagtcaggaaagccacaaatgtcacaaagggagcatttggtgacatgcttgac
actccggatccctatgtggagctgttcatcccatccgcccctgactgcaggaaaagaacc
aaacatttcaataacgatgtcaatcccgtgtgggacgagacctttgagttcattttggac
cccaaccaagacaacattcttgaggttactttgatggatgccaactacgtgatggatgaa
actcttggcacatccacatttcctatatcttctctgaaactgggagagaagaaggaggtc
cagttaactttcaatgacgtcacagaaatgaccttggaattgtctcttgaactcttcaac
tnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntgacgaggagaagaaatttcggcagcag
agaaaagagaatatcatgcacagcatgaaatcatttctaggagaggaaaacagcaagaac
ttgaccagttcccgtgatgtgccagtgatcgcagtgctgggctcaggaggtggatttcgc
gccatggtcggctttgctggcgtcatgaaagcgctttacgaatcgggagttttggactgc
gcgacgtacgttgctggtctctcaggatccacgtggtacatgtcgactttgtattcgcac
ccggattttccagagaaaggacccaaggagattaatcaagaattgatgaactctgtgagt
cacaacccacttctgctgctcactcctcagaaagtcaaacgctacatcgaagcgctgtgg
aataagaaaagctcaggccagcccgtcaccttcaccgatatctttggaatgctgataggt
gaaacacttatccataacagaatggacaccaccctgagcgacatgaaagagaaaatcaac
catgcccagtgcgctctcccactcttcacgtgtctccacgtcaaaccagatgtctcagag
ctcatgtttgcagactgggtggaattcagtccctatgagattggtatggccaagtatggc
acttttatgtctcctgatttgtttggaagcaaattttttatggggacagtggtgaagaag
tataatgaaaatccccttcatttcttgatgggtgtctggggcagtgccttttctatatta
tttaaccgagtgcttggcgtctccaattctcaaaataaaggtcccaccatggaagaagaa
ttagaaaatatcaggctaaagcacctcgtaagcaacgacagttcagacagtgaagatgaa
tcgcagcatccaaaaggcactgaaaacactgaggcgaatcaggagtatcagaacagcagc
caggagagctgggtgcagcggatgctgatggcgctggtgggcgacagtgcccttttcaac
accagggaagggcgtgctggaaaagtgcacaacttcatgctgggcttgaacctcaacagc
tgttacccgctctctcccctggcagatctcctgtcccaggagtccgtggaggaggacgag
ctcgatgctgccgttgcagatcctgatgagtttgagaggatatacgagccgttagatgtg
aagagcaagaagatccatatagtggacagcgggctcaccttcaacctgccgtacccgctt
atcttgagacctcaaagaggtgtcgatctcatcatctcttttgatttttctgcaaggcca
agtgattccagtcctcctttcaaagaaattttacttgctgaaaaatgggccaaaatgaac
aagcttcctttcccgaaaatcgacccgaatgtctttgatcgagagggcctgaaggagtgc
tatgttttcaaaccaaaggatacctcttcggagaaagactgtccaactatcatccatttt
gttttggccaacatcaacttccgcaagtacaaagctccaggcgttccgagagaaacgcag
gaagagaaggattttgcagactttgacatttttgatgatccaaatacaccgttctccacc
ttcaacttccaatatcccaacgaggcgttcaagaggcttcacgacctgatggagttcaac
accctcaataacatagacgtgatcaaacaagccatgatggagagcatcgagtacagaaaa
gagaacccgtcgcgctgctccgtgtcgctgagcagcgttgaagcgcggaggttctttaac
aagaccaatctgaacaacaacctgacgtag

DBGET integrated database retrieval system