KEGG   Columba livia (rock pigeon): 102089225
Entry
102089225         CDS       T02912                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:clv04040]
    102089225 (ASIC1)
Ion channels [BR:clv04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102089225 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 102089225
NCBI-ProteinID: XP_005515471
UniProt: R7VUA9
Position
Unknown
AA seq 527 aa
MMDLKVDEEEVDSGHPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
APEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGLGPPRSRAGYSPVLTPLPCAADET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATAGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYAKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCHKNHKRNNTD
KGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaagaggtggacagcgggcacccggtgagcatccag
gccttcgccagcagctccaccctgcacgggctctcgcacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggcactctgtttcctgggctcgctggcgctgctcgccctc
gtctgcaccaaccgcatccagtactacttcctctacccccacgtcaccaagctggacgag
gtggcggccaccaggctcaccttccccgccgtcaccttctgcaacctcaacgagttccgc
ttcagccgggtgaccaagaacgacctgtaccacgccggcgagcttctcgccctgctcaat
aacagatacgagatcccggacacccagactgccgatgagaagcagctggaaatcctgcag
gacaaggcgaacttccgaaacttcaagcccaaaccttttaacatgctggagttttacgac
cgggctggtcacgacatccgggagatgctgctgtcctgcttcttccgcggggagcaatgc
gcccctgaagacttcaaagtggtcttcacgcgctacggtaagtgctacaccttcaacgcg
gggcaggacgggaagccccggctcatcaccatgaaggggggcactggtttgggtccccct
cgcagcagggctgggtacagccccgtgctcaccccgcttccctgtgctgcagacgagacc
tcgttcgaagccgggatcaaggtgcagatccacagccaggacgagccgccgctcatcgac
cagctgggctttggggtggcccccggcttccagaccttcgtgtcctgccaggagcagcgg
ctcatctacctgccgcctccctggggtgactgcaaggccacggcgggcgactcggagttt
tacgacacctacagcatcaccgcctgccgcatcgactgcgagacgcgctacctggtggag
aactgcaactgccgcatggtgcacatgcccggggatgccccttattgcaccccggagcag
tacaaggagtgcgcggatcccgccttagatttcctggtggagaaggacaacgagtactgc
gtctgcgagatgccctgcaacgtcacccgctacgccaaagagctctccatggtgaagatc
cccagcaaagcctccgccaagtacctggccaagaagtacaacaagtcggagcagtacatc
ggggagaacatcctggtgctggatatcttcttcgaagccctgaactacgagacgatcgag
cagaagaaggcgtacgaggtggctggcttgctgggcgacattggggggcagatggggctg
ttcatcggggccagtatcctcacagtactggagctgtttgactacgcctacgaggtgata
aagcaccggctgtgccggcggggcaagtgccacaagaaccacaagaggaacaacacggac
aagggcgtcgcgctgagcatggacgacgtgaaacgccacaacccctgcgaaagcatacgg
ggccacccggcaggcatgacgtacgcagccaacatcctacctcaccacccggcccggggc
acctttgaggacttcacctgctaa

DBGET integrated database retrieval system