KEGG   Columba livia (rock pigeon): 102089756Help
Entry
102089756         CDS       T02912                                 

Gene name
OXCT1
Definition
(RefSeq) succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00072  Synthesis and degradation of ketone bodies
clv00280  Valine, leucine and isoleucine degradation
clv00650  Butanoate metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102089756 (OXCT1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    102089756 (OXCT1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102089756 (OXCT1)
Enzymes [BR:clv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     102089756 (OXCT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 102089756
NCBI-ProteinID: XP_021151007
Position
Unknown
AA seq 535 aa AA seqDB search
MRCPWVTGLEGAHLSPGYSSLKPGLPELQPPPEVLACWPGVQGRISGCFFSTSCHRNTKF
YTDPVEAVKDIPNGATILVGGFGLCGIPENLIGGLLKTGVKELTAVSNNAGVDNFGLGLL
LHTKQIKRMVSSYVGENAEFERQFLSGELEVELIPQGTLAERIRAGGAGIPAFYTSTGYG
TLVQEGGAPIKYNKDGTIAIASQPREVREFAGRHFILEQSITGDFALVKAWKADRAGNII
FRKTARNFNLPMCKAAKTTVVEVEEIVDIGAFAPEDIHVPKIYVDRLIKGEKFEKRIERL
SVRKPEDSKAKQKQGDNVRERIIRRAALEFEDGMYANLGIGIPLLASNFISPDITVHLQS
ENGVLGLGPYPLESEVDPDLINAGKETVTVLPGSSFFSSDESFAMIRGGHVDLTMLGAMQ
VSKYGDLANWMIPGKMVKGMGGAMDLVSSAQTKVVVTMEHSAKGNAHKILEKCNLPLTGK
QCVNRIITEKAVFDVDKKKGLTLVEIWEGLTVDDIKKCTGCDFTVSPKLTQMRQI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcccttgggtgaccgggctcgaaggagcacatctgtctccaggttactcctct
cttaaacctgggctgccggagttgcagccacctcctgaggtcttagcttgctggccaggt
gtgcaggggcgaatttctggatgctttttttctaccagctgtcatcgcaacaccaaattt
tatactgatcctgttgaagctgtaaaagatatacccaatggagcaactatacttgttggt
ggttttggattgtgtgggattcctgaaaacctcattgggggtttgctgaagactggagta
aaggaattaacagcagtcagtaacaatgcaggtgttgacaattttggacttggtcttctg
cttcatactaagcagataaaacgcatggtgtcatcgtatgttggagagaatgctgaattt
gaacgccagtttttatctggtgagcttgaagttgagcttatacctcagggtacactcgct
gaacgtattagagctggaggagcaggaatcccagcattttacaccagtaccggctatggg
acactggtgcaggaaggaggtgctcctattaagtacaacaaagatggcaccattgccatt
gccagccaaccgagagaggtacgagagtttgctggccgtcactttattctggagcagtcg
attacaggggattttgctcttgtgaaggcatggaaggctgatcgtgcaggaaacattatt
ttcaggaaaactgcaagaaatttcaacctacctatgtgcaaagctgccaagacaactgtg
gtagaggtggaagaaattgttgatataggagcatttgccccagaagacattcatgttccc
aaaatctatgttgatcgtctgataaagggagagaagttcgagaagagaattgaacgctta
tcagtccgaaagcctgaagactcaaaagccaaacaaaaacagggagacaatgtgagggag
aggatcatcagacgggctgctttagagtttgaggatggcatgtatgctaatctgggtatt
ggaattccactgttggccagtaacttcatcagtccagacattactgttcacttacagagt
gaaaatggagtcctaggtttgggtccttatccacttgaaagtgaagtagatccagacttg
attaacgcaggtaaggagacagtcactgttcttccaggttcttccttcttctctagcgat
gaatcatttgcaatgataagaggaggccatgttgatttgacaatgcttggagctatgcag
gtgtctaagtacggtgacctggccaactggatgattcctggtaagatggtgaaaggaatg
gggggtgccatggacctggtgtccagtgcgcagaccaaagtggttgtcaccatggagcac
tcagccaagggcaacgcacataaaatcttggaaaagtgcaatttaccacttactgggaaa
caatgtgtaaaccgcataattacagaaaaggctgtgtttgatgtggacaagaagaaaggg
ttgacccttgtggaaatctgggaaggactgacggtggatgatatcaagaaatgcactggc
tgtgacttcacagtttcgccaaaactgacacaaatgaggcagatttaa

DBGET integrated database retrieval system