KEGG   Columba livia (rock pigeon): 102089855Help
Entry
102089855         CDS       T02912                                 

Gene name
BST1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00760  Nicotinate and nicotinamide metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102089855 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:clv04090]
    102089855 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clv00537]
    102089855 (BST1)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102089855 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102089855 (BST1)
CD molecules [BR:clv04090]
 Proteins
  102089855 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clv00537]
 Enzymes
  102089855 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 102089855
NCBI-ProteinID: XP_021141816
Position
Unknown
AA seq 507 aa AA seqDB search
MMKSLFSSVVLVSVLFMNSFSEVQGGKWKGEGTTQNLESIVIGRCYDYIRIVNPAVGEKN
CSAIWEAFKNAFINKDPCNILPDDYELFINLSFHTIPPNKSLFWENNQLLVNSFAGRGRR
YMSLADTLFGFVADYLTWCGQANSTGLDYESCPTMEECENNAVESFWRKASATYAQHSSG
VIHVLLNGSVVGGAYPEPGFFADYEIPNLQKDKVSRIVIWVVDDIEGPDIESCGTHTVKI
LENRLKTLGYDVTCTDNYKSVMFLLCLDYPDDSKCALSSDKDCLKIWESLKHAFIYKNPC
NITSEDYEPLMELATHPIPCNKSLLWSKTSDVVHRYTKSNQNFLTLEDTLLGYMADRVSW
CGDPSDPGINYESCPKRSECESNPSSVFWKMASKLFAEAACGVVQVMLNGSVEAGAFRSS
SIFGSIEIFNLNPDKVSEVHIWLMHDIGGPQSESCSGHSIKRLKSILEERNFKITCVDNY
RPVQLLQCVHNPDHTDCRLCTNTTATP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagccttttttcgtctgtagtacttgtctctgttctgtttatgaacagcttc
tcagaagtgcaggggggaaaatggaaaggtgaaggtacaacacaaaacctggaaagtatt
gtcattggaagatgctatgactatattagaattgtgaatcctgctgttggtgagaagaat
tgttcagcgatatgggaagcatttaaaaatgcatttattaacaaggatccttgcaacatt
ctacctgacgactatgaattatttatcaacctgtcatttcacacaattccacccaacaag
tctctcttctgggaaaataatcagctgctcgtcaatagctttgctggcagaggccgtcgc
tacatgtctctggctgatactctgttcggctttgtcgcagattacctaacctggtgcggg
caggccaacagcactggactggactatgaatcctgccctaccatggaggagtgtgaaaat
aatgcggtggaatctttctggaggaaggcctcagccacttatgcacagcacagttctgga
gtgatacatgtcttgttgaatggctctgtagtcggaggagcttatccagaaccaggtttt
tttgcagattatgaaatacctaatctccagaaagacaaagtttcgcgaattgtcatctgg
gttgtggatgatattgaaggcccagatatagagtcctgtggaactcatactgtaaaaata
ttagaaaacaggctgaaaacccttggttatgatgtcacctgcactgacaattacaagtct
gtaatgttcttactctgcctggattatcctgatgattcgaagtgtgccctgtcatcagat
aaggattgcctaaaaatatgggaatcattaaaacacgcgttcatttacaagaatccctgt
aatattacatcagaggattatgagcctttaatggagttggcaactcatcctataccctgt
aacaagtcactgctttggagcaagacaagtgacgttgttcatcgttatacaaaatccaat
caaaatttccttaccttggaggacaccttgttgggttatatggctgatagggtttcatgg
tgtggagacccctctgacccaggaatcaactatgagtcttgtccaaaacgaagtgaatgt
gagagcaaccctagctctgtattttggaaaatggcatctaagctgtttgcagaagcagcc
tgtggtgtggttcaagtgatgctcaatgggtcagtagaagctggagctttcagaagcagc
agcatctttggaagtattgagatctttaacctaaatccagataaagtctctgaagtacac
atctggcttatgcatgacattggtggacctcaaagtgaatcctgctcaggtcattccata
aagaggttaaaaagcatcttagaagagcgaaactttaagatcacctgtgtggacaattac
aggccagttcagctccttcagtgtgtgcataaccctgaccacacagactgcagactttgc
accaacaccacggcaaccccatga

DBGET integrated database retrieval system