KEGG   Columba livia (rock pigeon): 102089943Help
Entry
102089943         CDS       T02912                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X5
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00071  Fatty acid degradation
clv01212  Fatty acid metabolism
clv03320  PPAR signaling pathway
clv04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102089943 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102089943 (CPT1A)
   03320 PPAR signaling pathway
    102089943 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:clv03029]
    102089943 (CPT1A)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102089943 (CPT1A)
Mitochondrial biogenesis [BR:clv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102089943 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102089943
NCBI-ProteinID: XP_005509107
UniProt: A0A2I0MI80
Position
Unknown
AA seq 770 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRMSHEALKQIYLSGVHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDTTGCMSNQTQNIVSGILFGTGLWVALIV
TMRYSLKMLLSYHGWMFAEHGKLSAGTRVWMALVKLFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVRPLMDDGEFRRMEGLAKDFAFNLGPRLQWYLKLKSWWATNYVSDWWEEYV
YLRGRGPIMVNSNYFAMDFLYLSPTTLQAARAGNVIHAILLYRKKLDRQEIKPILLMGST
VPLCSAQWERMFNTSRIPGEESDTLQHVKDSKHIVVYHKGRYFKVWLYHDGRLLKPREIE
QQMQRILDDDSEPQTGEKKLAALTAGDRVPWARARQAYFSHGKNKQSLDAVEKAAFFVTL
DDIEQGYRKEDPVRSLDAYAKSLIHGRCYDRWFDKTFTLIVFKNGRMGLNAEHSWADAPI
VGHLWENVMATEYLELGYSEDGHCKGDTNQNIPIPTKLQWEIPEECQEVIERSLSTAIAL
ADDVDFHSFFFDAFGKGLIKKAKTSPDGFVQLALQLAHYRDMGKFSLTYEASMTRLFREG
RTETVRSCTVESCNFVRTMEDPTESNENKLKLFQLAAAKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQHIDLKKNPEMLSCGGGFGPVADDGYGVS
YIILDEDSIHFHVSSKISCSDTDSHRFGKNIQKAMVDIMGLFNLSKNCTK
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcatcaagcagtagcttttcaatttacagttactccagatgggattgac
ctgcgaatgagccatgaggcactcaaacaaatttacctatctggtgtccattcatggaag
aaaaagttcatcagattcaagaatggaattatcactggcgtttatcctgctagcccatct
agctggcttattgtagttgtgggtgtgatgtcaacaatgtatgccaaaatcgatccttct
ctaggaataatagcaaaaatcaaccgaacacttgatacaactggctgtatgtcaaatcaa
acacagaacatcgtgagtggaatactttttggcacagggctttgggttgcccttattgtc
acaatgcgctactctctaaaaatgctgctttcctatcatggttggatgttcgctgaacat
ggcaaactttctgcaggcacgagggtttggatggcacttgtaaaactcttctcaggacga
aaaccaatgttatacagtttccagacatctttaccacgattgcctgttccagctgttaaa
gacacggtcaataggtatctagaatctgttcggccacttatggatgatggagagttcaga
agaatggagggtcttgccaaagattttgcatttaatttgggaccaaggcttcagtggtat
ttgaagctaaaatcctggtgggccacaaactatgttagtgattggtgggaagaatatgtc
taccttagaggacgtgggccaattatggttaatagcaactattttgcaatggacttcctt
tatttatctcccacaaccctgcaggcagctagagctggtaatgttatccatgccattctg
ctttatcggaaaaaactggacagacaagaaatcaagccaattcttctgatgggatctact
gttccactctgctcagctcagtgggaacgaatgtttaatacttcccgtatcccaggagag
gaatcagatactcttcagcatgtgaaagacagcaaacacatagttgtgtatcataagggc
cgttacttcaaggtgtggctgtaccatgatggtagactgttgaaaccccgagaaattgaa
cagcagatgcaaagaattcttgatgatgattcagagcctcagactggtgaaaagaaacta
gcagctcttactgcaggagatagagtaccatgggctagagctcgacaggcttattttagc
catggaaagaacaaacagtccttagatgctgttgaaaaagcagcattttttgtgacattg
gatgacattgagcaagggtacagaaaagaagatccagtgaggtcgctggatgcatatgca
aaatccttaatacacggcagatgttatgacagatggtttgataaaacattcactcttata
gtattcaaaaatggcagaatgggtctgaatgcagagcactcttgggcagatgctcctatt
gttggacacctgtgggagaatgtaatggcaactgagtatcttgaactgggctattcagaa
gatgggcattgcaaaggagataccaatcaaaatattcctattcctaccaaactacagtgg
gaaattccagaggaatgccaagaagtgattgagaggtctctgagcactgccatagctctg
gcagatgatgtggacttccattcatttttctttgatgcttttgggaagggactaataaag
aaagcaaaaaccagccctgatggctttgtgcaacttgccctgcagcttgctcactatcgg
gacatgggaaaattttctttaacatatgaagcctctatgacacgcttgttcagagaaggc
aggaccgaaactgttcgttcgtgtactgttgaatcatgtaattttgttcgaaccatggaa
gacccaactgaaagtaatgaaaataagcttaagttatttcagctcgctgctgccaaacat
cagcacttatatcgtcttgccatgactggtgctggcattgaccgccatctgttctgcctt
tatgtcgtgtcgaagtaccttgctgtagattctcctttccttaaggaagttttgtcagag
ccttggaggctgtcaacgagtcagacaccacagcaacacattgatctaaagaagaaccct
gagatgttatcctgtggtggaggatttggaccagtggctgatgatggttatggtgtctct
tatattatcttggatgaagattccatccatttccatgtctccagcaaaatatcatgttct
gacacggattctcatcgttttggaaaaaacatccaaaaagcaatggttgacatcatgggt
ttatttaatcttagtaaaaactgtaccaagtga

DBGET integrated database retrieval system