KEGG   Columba livia (rock pigeon): 102090867Help
Entry
102090867         CDS       T02912                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00450  Selenocompound metabolism
clv00970  Aminoacyl-tRNA biosynthesis
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102090867 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102090867 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clv01007]
    102090867 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clv03016]
    102090867 (MARS2)
Enzymes [BR:clv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     102090867 (MARS2)
Amino acid related enzymes [BR:clv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   102090867 (MARS2)
Transfer RNA biogenesis [BR:clv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102090867 (MARS2)
 Prokaryotic type
   Other AARSs
    102090867 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 102090867
NCBI-ProteinID: XP_021156440
Position
Unknown
AA seq 383 aa AA seqDB search
MFRLSAFRDPLWKWLRNNPRAIAPDPFYQHVLRWLEEDLPDLSVSRERSRLHWGIPVPGD
STQTVYVWVDALVNYLSVLGYPETHGEWWPAAHHVVGKDILKFHAVYWPALLMAAGLPPP
ERIFVHSHWTVRGQKMSKSLGNVIDPFACFGQYTVDGFRYFLLRQGVPERDCDYYDEKVV
KLVNSELADALGGLLNRSTALSINPSNTYPCFSESCFPKILDSGETEGTGRVSAEDYEFV
ASVASLPLQVAGYFEGFQIYKALECIAVCVRQTNSFFQRHRPWKLNRKDPAEQLWLDTII
HVTLECLRVYGTLLQPVIPHTADKLLSRLAVEPEERGLSSLTFLPRYNGQPCPFEGRQLG
PDTGVLFHRLEKPGQHQTETKKL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggctctcagcgttccgggacccgttgtggaagtggctccggaacaacccccgt
gccattgcccccgaccctttctaccagcacgtgctccgctggctggaagaggacttgccg
gacttgtcggtctctcgtgagcgaagccggctgcactggggtatccctgtccccggtgac
tccacacaaactgtttacgtttgggtcgatgccttggtgaactatctgagcgtgctgggc
tacccggagacgcacggcgagtggtggcctgcggcacatcatgttgtgggcaaggacatc
ctcaagtttcatgctgtgtactggcccgcgctgctgatggcagcagggctgccccccccc
gagcggatctttgtgcactcccactggactgtccgtgggcagaagatgtccaaaagcctg
ggcaacgtgattgacccctttgcttgctttggacagtacacagtagatggatttcggtac
ttcttgctaaggcagggggtacctgagcgggattgtgactattatgatgagaaggttgtg
aagcttgtgaattcggaactggcagatgcgctcggagggcttctgaatcggtcaacagcc
ctcagcattaaccccagcaacacttacccgtgtttctcagagtcctgttttccaaagatc
ttggattccggggagacagaaggcacgggtagagtctctgccgaagactacgagttcgtg
gcatctgtggcttctctgcctctgcaagtggctggttattttgaaggtttccagatctac
aaggctttagaatgcattgccgtgtgtgtaaggcagaccaacagtttcttccagagacac
aggccttggaaactcaaccgaaaagaccccgcagagcagctctggcttgacaccatcatc
cacgttacgctggaatgcctgcgtgtctacgggactctgctgcagcccgtgatcccacac
actgcagacaagttgctttccagactggctgttgagccagaagagaggggtctctccagt
ttgacatttctgccacgttacaatgggcagccctgtcccttcgaggggagacagctcggc
cctgacaccggcgtcttatttcacagactagagaagccaggacagcatcagacagaaacc
aagaagctctag

DBGET integrated database retrieval system