KEGG   Columba livia (rock pigeon): 102091284Help
Entry
102091284         CDS       T02912                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00230  Purine metabolism
clv01100  Metabolic pathways
clv04270  Vascular smooth muscle contraction
clv04540  Gap junction
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102091284
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102091284
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102091284
Enzymes [BR:clv01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102091284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 102091284
NCBI-ProteinID: XP_021136016
Position
Unknown
AA seq 688 aa AA seqDB search
MLRTLGGNLYEFIENLDALHSYLSLSYQEMNAPSFRVEKNEDGSMHLHYYSDRRGLCHIV
PGIIGAAALDFFNIEISMEIVNQTEEEERTGKKEHIVFLVTQNPVFSYKERKTFSSSPQY
LADCEKQIENPXNTIRDRGSSVCPVKKSHWKTLRGVITLGKGKLLRGFEPVYPKSLWIDT
KTFCNGLPFHMVFDKELRVKQAGVSIQKIVPGLQTMGICLDHYFSIVHPEVPFTISSIQK
FINSQFVFQTRREMMPESWKQRPMLELRGQMIWMESLQCMLYLCSPLLRTLHELEERQMH
IADIAPHDVTRDLILLNQQRLAEMELSNQLERKKEELRILSKHLEDEKKKTEALLYAMLP
QHVANQLKEGKRVEAGEFKECTILFSDVVTFTNICAQCEPIQIVLMLNSMYLRFDRLTTV
HDVYKVETIGDAYMVVGGVPVPVPTHAERVANFALGIIIAAKGVQNPVSGNPIQIRVGIH
TGPVLAGVVGEKMPRYCLFGDTVNIASRMESHGVPSKIHLSSSAYQCLKYKNFEMTERGE
IEVKGKGKMYTYFLIRNKTATENEIMGRPMKDLDSGHESVQSFQEGRTETVPSCHQPVTQ
TQPEKDQTPAIAMKYIDAPTEAQNSLKRRNQAKIADLTGKSYDFESDGSLHGNQHADDGP
CPLNQRRIKPATEEPQIRNVRSNFCTLL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacactgggtggaaatctctatgaattcatagagaacctggatgcattgcac
agctacctgtccctttcttaccaggagatgaatgccccatcttttagagtagaaaagaat
gaagacgggtcaatgcatttacattactattcagatagaagaggtctgtgccatattgtg
ccaggaattattggtgcagcagccctggatttttttaacattgagatttcaatggaaata
gtcaatcaaacagaggaagaagaaagaactggtaaaaaagaacatattgtttttcttgtc
actcaaaaccctgtattttcatacaaggaaagaaagacattttcttcctctcctcaatat
cttgctgactgtgaaaaacaaattgagaacccnnngaatacaattagagacagaggaagc
tctgtttgtcctgtcaagaaaagtcactggaaaacattaagaggagtaatcacattagga
aaaggtaagctcctgagaggatttgagcctgtttatcctaagagcctctggattgacaca
aaaacattttgcaatggacttccttttcatatggtttttgacaaagagctcagagtgaag
caagctggggtgagcattcaaaagattgtacctggccttcagaccatgggcatctgcttg
gatcactatttcagtattgttcatccagaggtacccttcaccatctctagcattcagaaa
ttcatcaacagccaatttgtcttccagactagaagagagatgatgccagaatcatggaaa
caacggccaatgctagagctgagaggccagatgatctggatggagtccctgcagtgcatg
ctctatctctgttcacctttgcttcgcactttgcatgaactggaggagcgacagatgcat
attgcagatattgcacctcacgatgtgaccagggatctgattcttctcaatcagcagcga
ctggcagagatggagctctctaaccagctggagaggaagaaggaagaactgcggatactg
tcgaagcacctggaggatgagaagaagaagactgaagctctgctctatgccatgcttcct
cagcatgtggccaaccagctgaaagaggggaagcgagttgaggcaggagaattcaaggag
tgcaccatattattcagcgacgttgtgacctttaccaacatttgtgcccaatgtgagcct
attcagatagttctcatgttaaattcaatgtacctacgatttgacagactgacgacagtg
catgatgtgtacaaggtggagacaattggagatgcctatatggtagtaggtggcgtccct
gttcctgtccccacccatgctgagcgagttgctaactttgccttggggattataatagca
gctaaaggagtacagaacccagtttctggaaatcctattcagattagagttgggatccat
acaggtcctgtcttggctggagttgttggagaaaagatgcctcgttattgcttgtttgga
gacacggtgaatatagcttcccggatggagagtcatggtgtcccgagtaaaattcatcta
agctccagtgcctaccaatgcctaaaatacaagaattttgagatgactgaaagaggagaa
atagaagtgaaaggcaaagggaaaatgtatacatacttcctcattagaaataaaactgca
actgagaatgagattatgggaaggccaatgaaagacttagattctggccatgaatctgtt
cagtcttttcaagaaggcaggactgaaacagtaccaagttgtcatcagccagttactcag
actcagccagagaaggaccagaccccagccattgcaatgaagtatattgatgcccccaca
gaggcacaaaacagcctcaaaagaagaaatcaagcgaaaattgcagatttaacaggcaaa
agttatgatttcgaaagtgatgggagtctccatggcaaccagcatgcggatgatggtcct
tgtcctctaaaccagagaagaatcaaacctgctactgaagagccacagatcagaaatgtt
cgctctaatttctgcactttactctaa

DBGET integrated database retrieval system