KEGG   Columba livia (rock pigeon): 102092948
Entry
102092948         CDS       T02912                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00230  Purine metabolism
clv00240  Pyrimidine metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102092948 (DCK)
   00240 Pyrimidine metabolism
    102092948 (DCK)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102092948 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_28 AAA_18 AAA_33 AAA_17
Other DBs
NCBI-GeneID: 102092948
NCBI-ProteinID: XP_005504358
Position
Unknown
AA seq 254 aa
MATPPKRGRRDGRTKKACHQVKAAGKSTFVDILKQAGEEWEVVPEPVARWCNVQQSSEEG
CEDLKYKSGKSVLSFMWQKPERWSFTFQTYACLSRIRAQLSSLDGKLREAENPAVFFERS
VYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNEQFGQSLALDGIIYLRATPEKCLNRI
YLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFEYLQEIPILTLDGNEDFKGKKDRY
DHMTEKVKEFLSTL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccacccctcccaagcgcggccggcgggacggccgcaccaagaaggcgtgtcatcaa
gtcaaagctgcagggaaatcgacctttgtggatattctcaaacaagcgggcgaggaatgg
gaagttgttccggagccggtagctagatggtgcaatgtgcagcagagctcggaggagggt
tgtgaggatttaaagtataaaagcggtaaaagtgtgctctcttttatgtggcagaaaccg
gagcgctggtcgttcactttccagacgtacgcgtgcctcagccggatccgggcgcagctc
agctcgctggacggcaagctcagagaggcggagaatcctgcggtcttcttcgagcggtct
gtctacagtgacaggtatatttttgcagctaatttatatgagtctgattgcatgaatgaa
acggaatggactatttaccaagactggcacgactggatgaacgagcaatttggtcaaagt
ctggcgctggatgggatcatttatctcagagccactcctgagaaatgcttaaataggatt
tacttgcgtggaagagatgaagaacaggaaattcccattgaatatctggagaaacttcac
tacaaacatgaaagttggcttcagcacaggacactgagaacggattttgaatatctccag
gaaatacctattttaacgttagatggtaatgaagacttcaaaggcaaaaaggacagatac
gatcacatgactgaaaaggtcaaagaatttttgagcaccttataa

DBGET integrated database retrieval system