KEGG   Columba livia (rock pigeon): 102093093Help
Entry
102093093         CDS       T02912                                 

Gene name
ALG2
Definition
(RefSeq) alpha-1,3/1,6-mannosyltransferase ALG2
  KO
K03843  alpha-1,3/alpha-1,6-mannosyltransferase [EC:2.4.1.132 2.4.1.257]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00510  N-Glycan biosynthesis
clv00513  Various types of N-glycan biosynthesis
clv01100  Metabolic pathways
Module
clv_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102093093 (ALG2)
   00513 Various types of N-glycan biosynthesis
    102093093 (ALG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:clv01003]
    102093093 (ALG2)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.132  GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     102093093 (ALG2)
    2.4.1.257  GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     102093093 (ALG2)
Glycosyltransferases [BR:clv01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   102093093 (ALG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 102093093
NCBI-ProteinID: XP_005509877
UniProt: A0A2I0MVU7
Position
Unknown
AA seq 323 aa AA seqDB search
MAFVALYVLLLSGEHADAFVCDQVSACIPVLRLARIRKKVLFYCHFPDQLLTKRESFLKR
IYRLPLDWLEEFTTGMADCIVVNSKFTASVFKDTFKSLSHISPDVLYPSLNISSFETIVP
ADIADLIPKKKKFLFLSINRYERKKNLSLALEALHELRGRLDSHEWNEVHLVMAGGYDER
VLENVEHYEELRSLATKLKVNDHVTFLRSFSDEQKISLFSNSVCVLYTPSNEHFGIVPLE
AMYMRCPVIAVNSGGPLESVLHNVTGFLCDPLPTQFSEAMEKIVRDPLLKDTMGAAGRDR
VMEKFSSEAFAEQLYQYICRLTQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgtggcgctgtacgtcctgctgctcagcggagagcacgccgacgccttcgtc
tgcgaccaggtgtctgcttgcattcctgtgcttagactggccagaattcgtaagaaggtt
ttgttttactgtcattttcctgatcagcttctgaccaagagagaatctttcctgaagcgc
atttacagattaccgcttgactggctggaagagttcacgactggcatggcagactgtatt
gttgtgaacagcaagttcactgccagtgtgttcaaggacacgtttaagtccttatctcac
ataagcccagacgtcctctacccatcactcaacatcagtagctttgaaacaatagttcct
gcggacatagctgacctcatacccaaaaagaaaaagttcttgtttctttccattaataga
tacgagagaaaaaagaatctatcattggctctggaagctttgcatgagcttcgaggaaga
cttgattctcatgagtggaatgaagttcacctggttatggcaggtggttatgatgaacgg
gttctggaaaacgtggagcactatgaagagctgaggagccttgcaaccaagcttaaagtt
aacgaccacgtcacttttctgagatcgttctcagatgaacagaaaatctctctttttagt
aactctgtatgtgtactttatacaccgagcaatgaacattttggcattgttcctctggag
gcaatgtatatgagatgcccagttatagcagttaattcaggtggtcctttagaatcagtc
ttgcataacgttacaggatttttgtgtgatcctctgccaacgcaattctctgaggccatg
gaaaaaattgtgagagatcctctcttaaaggacacaatgggagcagctgggagagacaga
gttatggaaaaattttcttcagaagcatttgcagaacagctgtaccaatatatatgcaga
ttaacacaataa

DBGET integrated database retrieval system