KEGG   Columba livia (rock pigeon): 102093169Help
Entry
102093169         CDS       T02912                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00564  Glycerophospholipid metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102093169 (ETNPPL)
Enzymes [BR:clv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     102093169 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 102093169
NCBI-ProteinID: XP_005515278
UniProt: A0A2I0M970
Position
Unknown
AA seq 487 aa AA seqDB search
MTDIRPSCKVFFAKDPLKIVWAQGQYMFDEKGEKYLDCINNVAHVGHSHPYVIKAATKQM
ELLNTNSRFLHDNLVQYAQRLTATLPEKLSVCYFVNSGSEANDLALRLARWYHGHQDVIT
LENAYHGHVTSVIDISPYKFNELGKDSKKEFVHVAPSPDIYRGKYREDHPDPASAYAEEV
KKIIEETEKSGRKIAAFIAESMQSCGGQIIPPVGYFQKVAEYVRAAGGVFIADEVQVGFG
RVGKHFWAFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTREIAESFGASGLEYFNTFGGN
PVSCAIGLAVLEVIEKEDLQGNATRVGSYLLELLAEQKEKHPLVGDIRGVGLFVGVDLVR
DRQMRTPATAEALHLIYKLKEHQILLSADGPHRNVLKFKPPMCFSMEDAKHVVETIDVLL
TEMEEANGMKTENDASTNAQCKRKMTEGSSQPEGAIESITHMNGTACRQENGLFSKKCTV
PSERIRT
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatcaggccttcctgcaaagttttctttgccaaggaccctctgaagatagtg
tgggctcagggccaatatatgttcgatgagaaaggagaaaaatacttagactgtatcaac
aatgttgcacatgttggccacagtcatccatacgtgataaaggctgcgacaaagcagatg
gaactgctcaacacaaattcccggttcctgcatgacaaccttgttcagtacgcacagcgg
cttacagccaccctgcccgagaaactgtctgtttgctattttgttaactctgggtctgaa
gctaatgatcttgctttacgactggctcgatggtaccatgggcaccaagatgtgatcacc
cttgaaaatgcttaccatggccacgttacctctgtgattgacatcagtccctataaattt
aatgagctgggaaaggacagcaagaaggagtttgtgcatgtggctccttctccagatatc
tacagagggaaatatagggaagatcacccagatccagcaagtgcttatgctgaagaagtg
aaaaagattattgaagaaacagagaagagtggacgcaagattgctgccttcatagccgaa
tccatgcagagctgtggaggccaaataattccacctgtgggctatttccagaaagtggca
gagtatgtgcgtgctgcaggtggtgtgttcatagctgatgaggtccaggttggctttggc
agagttgggaagcatttttgggcattccagctgcaaggcgaagacttcgtgcctgacatt
gtcaccatggggaagcccattggcaatggccaccctatgtcctgtgtggtcacaacaagg
gaaattgctgaaagttttggtgcttctggactggagtatttcaatacatttggaggaaat
ccagtgtcttgtgctattggtctggctgtgctagaggtaatagagaaagaagatctccaa
ggaaatgctacacgtgtaggaagttacctcctggagctgctggctgagcaaaaggagaaa
catcccttagtgggagatatcaggggtgtgggcttgtttgttggagtggatctggtgaga
gatcgacaaatgcgaacaccagccacagctgaagccctccaccttatttacaagctgaaa
gagcatcaaatacttcttagtgcagacggacctcacagaaacgtactaaaatttaaacca
ccaatgtgtttcagtatggaggatgcaaaacatgtcgtggagacaattgatgtacttctc
acagaaatggaagaggcaaatggaatgaagacagaaaatgatgcatctacaaatgcacag
tgtaaaagaaaaatgactgaaggcagttctcaaccagaaggcgcaattgaaagcatcacc
catatgaatggaaccgcctgcagacaagaaaatgggcttttttctaaaaaatgcacagtg
ccaagtgaaagaataagaacatga

DBGET integrated database retrieval system