KEGG   Columba livia (rock pigeon): 102093919Help
Entry
102093919         CDS       T02912                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00480  Glutathione metabolism
clv00590  Arachidonic acid metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102093919 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102093919 (GPX3)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102093919 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102093919
NCBI-ProteinID: XP_005503440
Position
Unknown
AA seq 227 aa AA seqDB search
MGGWSRSAWILPLFLAGLVQPGQSQEREKVKCYDSVPGTIYDYGALTIDGDEYIPFRNYA
GKMVLFVNVATYUGLTLQYLELNALQNELGPYGLVVLGFPSNQFGKQEPGQNSEILPALK
YVRPGGGFVPNFQLFQKGDVNGAKEQKVFTFLKNSCPPVAEEFGNPKNLFWEPLRNHDIK
WNFEKFLVGPDGVPVMRWYHRANIAVVKNDIIAYMRQQQQQPLPQGQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggggggctggtcccgcagcgcctggattttgccccttttcttggctgggcttgtccag
ccgggacagagccaggagagggagaaggtgaaatgctacgactcagtgccgggcaccatc
tacgactacggggctctgaccatcgatggggacgagtacatcccctttaggaactacgca
gggaagatggttctctttgtcaacgtggccacatactgaggcctcaccctgcagtacctt
gaactgaatgcactacaaaacgagctggggccctatgggctcgtcgtcctgggcttccct
tccaaccaattcggaaagcaggaacccggccagaactcggagatcctccctgctctgaag
tatgtccggccaggtggtggctttgtccccaacttccagctcttccagaaaggggatgtg
aacggggccaaggagcagaaggtcttcaccttcctgaagaactcctgtcccccggtggca
gaggagtttgggaaccccaagaacctcttctgggagcctcttcggaaccacgacatcaag
tggaactttgagaagttcctggtgggccccgacggcgtgcccgtcatgcgctggtaccac
cgcgccaacatcgccgttgtgaagaacgacatcatcgcctacatgaggcagcagcagcag
cagccgctgccacagggccagtag

DBGET integrated database retrieval system