KEGG   Columba livia (rock pigeon): 102094361Help
Entry
102094361         CDS       T02912                                 

Gene name
NLN
Definition
(RefSeq) neurolysin, mitochondrial isoform X1
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102094361 (NLN)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     102094361 (NLN)
Peptidases and inhibitors [BR:clv01002]
 Metallo peptidases
  Family M3
   102094361 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 102094361
NCBI-ProteinID: XP_005506018
UniProt: A0A2I0M172
Position
Unknown
AA seq 680 aa AA seqDB search
MTLGAEITSQLKASSYLASGRNLLRWDLSPEQIRTRTEELIRKTKHVYDTVGMLDTGEVT
HENTVRALADIEVEYAVERSMLDFPQHVSPDKEVRLASTEADKKLSNFDVEMSMREDVFQ
KIVYLQQSCNLENVKPETKRYLEKSVQVGKRNGLHLPKEVQNEIKMMKKKMSELCIDFNK
NLNEENTFLTFSKEELEGLPDDFIKSLEKTEEEKYKITLKYPHYYPVMKKCCISETRRKM
EFAFNSRCKEENTKILQQLLPLRAKVAELLGYNTHANFVLEVNTAKSTDNVTAFLDDLSK
KLKPLVEEEREFILDLKKKECKERNFDYDGRINAWDLHYYMNKTEELKYSIDQEKLKEYF
PIEAVTEGLLNIYQKLLGLVFEQVESAHVWHDSVTLYTVKDNSTGEMLGQFYLDLYPREG
KYGHAACFGLQPGCLLSDGSRMMSVAALVTNFTKPASDHPSLLRHDEVKTYFHEFGHVMH
QICAQTDFARFSGTNVETDFVEVPSQMFENWVWEKEPLQQMSRHYKDESHVADTLLEKLA
ASRLANTGLLTLRQIVLSKVDQALHTKPSVDPADEYAKCCMEILGIHATPGTNMPATFGH
LAGGYDGQYYGYLWSEVFSMDIFYSCFKQEGILNPKAGMKYRNLILKPGGSLDGMDMLQN
FLDRKPSQRAFLLSKGLCVQ
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacattaggagcagaaattactagccagctcaaggcttcttcatacttagcatcaggc
cgaaaccttttgagatgggacctatcaccagagcaaattagaacaagaacagaagaacta
atcaggaaaacaaagcatgtatatgacactgttgggatgcttgatactggagaagtaaca
catgaaaatactgtacgggccttggcagatatagaagtcgaatatgcagtggaaagaagc
atgttggattttccccagcatgtctcacctgacaaagaggtacgcttagcaagtacagaa
gctgacaaaaagctttctaattttgatgtggagatgagcatgagagaagatgtgtttcag
aagattgtctatctgcagcaatcctgcaatcttgaaaatgtaaagcctgaaacaaagcga
tatctagagaaatcggttcaagttggaaaaagaaatggactccatcttcctaaagaagtg
cagaatgaaataaagatgatgaagaaaaaaatgagtgagctgtgtatagactttaacaaa
aacctgaatgaggaaaacacctttcttacattttctaaggaagaacttgaaggccttcct
gatgactttattaagagcttagagaagactgaggaagaaaaatataaaattactttaaag
tatccccactattatcctgtcatgaagaagtgctgcatttcagaaaccaggagaaaaatg
gagtttgcctttaactcaagatgcaaagaggagaacacaaaaatccttcagcagttgctt
ccactaagggcaaaagtagcggagcttcttggttataatacacatgccaactttgtcctg
gaggtaaacactgcaaagagcacagataatgtaacagccttcttagatgatttgagtaag
aagctaaaaccattggttgaagaagaaagggaatttattctggatttgaagaaaaaggag
tgtaaagaaagaaactttgattatgatggaagaatcaatgcatgggatcttcattattat
atgaacaagacagaagagctgaagtactccatagatcaagaaaagctgaaggaatacttc
ccaattgaggctgttacagaaggcttactgaatatttaccagaaactactgggacttgta
tttgagcaagtagaaagtgctcatgtttggcatgacagcgttactctttatacagtaaag
gataattcaacaggagagatgttagggcaattctatttggacctttaccccagagaagga
aagtatgggcatgcagcgtgctttggtctccagcctggctgtcttctatctgatggcagc
agaatgatgtctgtagctgctctggtaaccaacttcacaaaaccagcatcagatcaccct
tcattgctgcgacatgatgaagtaaagacttacttccatgaatttggtcatgtaatgcat
cagatatgtgcacagactgattttgctaggtttagtggaactaatgtggaaacagacttt
gtagaggtaccttcacaaatgtttgagaactgggtgtgggaaaaagaaccactacagcaa
atgtcaagacattataaagatgagagccatgttgcagacactctccttgagaaacttgct
gcctctagactggctaatacaggccttttaacactccgtcagattgttttgagcaaagtt
gaccaggcactgcatacaaaaccatctgttgacccagcagatgaatatgccaaatgctgt
atggagattctaggaattcatgccaccccaggaacaaacatgccagctacttttggacat
ctggcaggtggatatgatggtcaatactatggctacctgtggagtgaagtgttttctatg
gacatattttatagctgctttaagcaagaaggaatattgaatccaaaggctgggatgaaa
tacagaaatctaattttgaaacctggaggatctttggatgggatggatatgctacaaaat
ttcttggatcgtaaaccgagccagagagctttcctattgagtaaaggattgtgtgttcag
taa

DBGET integrated database retrieval system