KEGG   Columba livia (rock pigeon): 102094662
Entry
102094662         CDS       T02912                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102094662
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102094662
Peptidases and inhibitors [BR:clv01002]
 Metallo peptidases
  Family M1
   102094662
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102094662
NCBI-ProteinID: XP_021146747
Position
Unknown
AA seq 799 aa
MCVCAEVPWVVVEQPWQLRGLVLRSPSRGLRVLAATQFEPTAARMAFPCFDEPAFKATFS
VKIRREPKHLALSNMPIVKSVSLTPWLVEDHFDTTVKMSTYLVAFIVSDFKSISKTTSHG
IKVSVYAAPDKIHQAGYALDAAVKLLDFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGL
TTYRESALLYDPEKSSASSKLWITMVIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEF
VSVRVTHPELAVEDHFLRRCFDAMEVDALDSSHPISTPVEDPAQILEMFDDVSYEKGSCI
LNMLRDYLTADVFKAGLVQYLQKYSYKNTRNADLWNSMTNICPTVGTDKNELEGGGFCRS
QQSPSAAHWTKGEALDVRAMMDTWTLQKGFPLVTVTLRGRNVHLQQERYVKGDGSPSSAG
RYLWHIPLTYITSKSNQVQRFLMTTKADVIILPEEVEWVKFNVDMNGYYIVHYEDDGWDR
LINLLKENHTVISSNDRASLVNNAFQLVRTKKLSISKAFDLTLYLKHERQIMPVLQGLSE
LIPVYRLMERRGAGGTEKRLQEYIVNLFKELIDGQSWSDEGSVSARLLRSSLLLFACVHR
YPPCVRRATELFTEWQKSDGTLRLPADVRSAVYAVGAQTPRGWDFLLRKYRLHSFHLEKN
NIEFALSLSERQEELRWLMDQGLRGDIIRTQDLPHIIIYVAKNPSGYHLAWEFLKENWEK
IVEKFELGSNSVAGIVAGVTSRYSTRSHLAQVKEFFGSAGEKSAQLRCVQQAIETIEDNI
EWMDRNFEEVKAWLQNNHL
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgtgtgtctgtgctgaggttccctgggtcgtggtggagcagccatggcagctgcggggc
ctggtgctccgcagcccctccaggggacttcgagtgcttgcagcaacgcagttcgagccg
acggcggcgcggatggccttcccgtgcttcgacgagccggcctttaaagccacgttctcg
gttaagatcaggagggagccgaagcacctcgcgctgtccaacatgcccattgtgaagtct
gtgagtttaacgccctggctcgttgaagaccattttgatacgacggtcaagatgagcacg
tacctcgtggccttcatcgtttcggattttaaatccatcagcaaaacgaccagtcatgga
attaaggtttccgtgtacgcggcgcccgacaagatccaccaggctggctacgccctggac
gctgcggtgaagcttctggacttctacgaggactacttcagcattccgtatccgctgccc
aaacaagacttggcagctattcccgatttccagtctggcgctatggaaaactggggactg
accacataccgggaatccgcgttgttgtacgaccccgagaagtcctcggcatcttctaag
ctgtggattactatggtcatagcccacgagctggctcaccagtggtttggcaacctcgtt
accatggagtggtggaacgacctgtggttaaacgaggggtttgccaagttcatggagttt
gtgtcggtccgtgttacccacccagagctggcagttgaagaccatttcttgaggagatgt
tttgatgccatggaagtggatgcactagattcgtcacatcccatctctactcctgtggaa
gatccagctcaaatcttagaaatgtttgatgacgtttcttatgagaagggatcttgtata
ttaaacatgctgagggactacctgactgctgatgtgttcaaagctggacttgtgcagtac
ctgcagaagtacagctacaagaatacgagaaatgcagacctgtggaacagcatgacgaat
atttgccctacagtgggtactgacaaaaatgaactagaaggtggtggtttctgcagaagc
caacagtcgccgtcagctgcacactggacgaagggagaggctctggacgtgagggcgatg
atggacacgtggacgctgcagaagggctttcccctggtgaccgtgacgctgagagggagg
aacgtccacctgcagcaggagcgctacgtgaaaggggacggttctccctcctccgcaggt
agatacttgtggcacattccactaacctacattaccagtaaatccaaccaggtccagaga
tttttgatgacaactaaagcagatgtcattatccttccagaagaggtggagtgggttaaa
ttcaacgtggacatgaacgggtattacattgtgcactatgaagatgacggatgggatcgt
ctcattaaccttttgaaagagaaccacacggtgattagcagcaatgacagagcaagtctc
gttaacaacgcattccagctcgtgagaacaaaaaaattgtcaatttccaaagcttttgat
ttaactttatacctgaaacacgagcgacaaatcatgcccgtgctccaagggctgagcgag
ctgatccccgtgtacaggctgatggagaggaggggtgcgggtggcacagaaaaacgcctg
caggagtacatagtcaacctgtttaaggagctgattgacggtcagtcatggagcgacgag
gggtcggtgtcggcgcggctgctgaggagctcgctgctgctgttcgcctgtgtgcaccgg
tacccgccctgcgtgcgccgggccaccgagctcttcactgagtggcagaaatccgacggg
accctcaggctgccggcggacgtgcggagcgccgtgtacgccgtgggcgcgcagacaccg
cgcgggtgggatttcctgctccgcaaataccggctgcactccttccacctggagaaaaac
aacatcgagttcgcgctcagcctcagcgaacgccaggaggagctgcggtggttgatggat
caaggtctgcgtggcgacatcataagaactcaggatcttccacacattattatatatgtt
gccaaaaacccttctggctatcatctggcttgggagtttttgaaagaaaattgggagaaa
attgtagaaaagtttgagcttggttcgaactccgtagcaggaattgttgcgggggtgacg
agtcggtactcgacaaggtcacatcttgcacaggtgaaagaattcttcggttctgccggg
gagaaaagcgctcagcttcggtgcgtgcagcaggcgatcgagaccatcgaggacaacatc
gaatggatggacagaaacttcgaggaagtcaaagcgtggctgcaaaacaaccacctgtaa

DBGET integrated database retrieval system