KEGG   Columba livia (rock pigeon): 102094678Help
Entry
102094678         CDS       T02912                                 

Gene name
ERP44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102094678 (ERP44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102094678 (ERP44)
Membrane trafficking [BR:clv04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    102094678 (ERP44)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102094678 (ERP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 HyaE
Motif
Other DBs
NCBI-GeneID: 102094678
NCBI-ProteinID: XP_005509886
UniProt: A0A2I0MVV0
Position
Unknown
AA seq 344 aa AA seqDB search
MLHPIFEEASNVIKEEYPDKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKRE
YRGQRSVTAIADYIRQQKSNPIREVQDLEEINSLDRSRRNIIGYFEQKDSDNYRTFERVA
NILHDDCVFLSAFGAVSKAERFSGDNVIYKPPGENAPDMVYLGSLTNFDLIYAWTQDKCV
PLVREITFENGEELTEEGLPFLILFHMKDDLESLEKFQQEVARQLISEKGTINFLHADCD
KFRHPLLHIQKTPADCPVIAIDSFKHMYVFPDFSDLSVPGKLKQFVLDLHSGKLHREFHH
GPDPTDVAPGQPIQDLASSPPESSFQKLAPSEHRYTLLREKDEL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctacatcctatttttgaggaagcttctaatgtaatcaaggaagaatatccagataag
aatcaagtggtatttgctagagtagactgtgaccagcattcggatatagctcagagatac
aggataagcaaatatccaactctgaaactcttccggaatgggatgatgatgaagagagaa
tacaggggccagagatctgtgacagcaatagcagattatatcaggcagcagaagagtaac
ccgattcgggaggtccaggatttggaagaaataaattctcttgatcgcagcagaagaaat
attattggatactttgagcaaaaggactctgacaattacagaacctttgaaagagtagcg
aatattttgcatgatgattgtgtattcctgtctgcctttggggctgtttcaaaagcagag
agatttagcggagacaatgtaatctacaagccaccaggggaaaatgctccagatatggta
tatttaggctcgctaaccaattttgatttgatttatgcatggacacaagataaatgtgta
ccactagttcgagaaattacatttgaaaatggggaggaactgacagaagaaggccttcct
tttctcatacttttccacatgaaagacgacttggagagtttagagaaattccaacaggag
gttgcacgacagttaataagtgaaaaaggtacaataaacttcctccatgctgactgtgat
aaattcaggcacccactcctccacattcagaagactccagcagactgcccggttattgcc
attgacagctttaagcacatgtatgtcttcccagacttcagcgacttgtcagtcccaggt
aaactgaagcaatttgtactagacttgcattctggaaaattgcacagagagtttcatcat
ggccctgatccaactgatgtagcacctggtcagccaattcaggatttagcaagcagccca
ccagagagctcattccagaagctggcacccagtgaacataggtacaccttattgagggaa
aaagatgaactttaa

DBGET integrated database retrieval system