KEGG   Columba livia (rock pigeon): 102094803Help
Entry
102094803         CDS       T02912                                 

Gene name
TMPRSS15
Definition
(RefSeq) enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102094803 (TMPRSS15)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     102094803 (TMPRSS15)
Peptidases and inhibitors [BR:clv01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102094803 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM Ldl_recept_a DUF1986 SRCR_2 SRCR CUB_2 Trypsin_2 PRKCSH-like
Motif
Other DBs
NCBI-GeneID: 102094803
NCBI-ProteinID: XP_021155278
Position
Unknown
AA seq 884 aa AA seqDB search
MMPVTSSDPVSLTTSPLTPTPGSGQLTTSRSSTTADSVSLTTSPLTPTSGSGQHTTSKTS
TAAGIRSYLFCDGVSDCPDGSDESEERCASVCDGKFMLTDSSGFFHSMNYPKPYNENIIC
QWIILVPQGLSIKLNFTSFDTQQYVDILDIFEGIGQTKILRASLSGINPETIYIFSHEAT
AQFVSDYSENHDGFNAMYTAFNASELNNYEKINCTFEDGLCYWIQDLDDDSDWERVQGPN
FPFMSGPDFDHTLGNESGFYISTPIGIGFIGERVRIRSLPLVSPDPSCLSFWYFMYSPNV
YRLRVIISNEHGSEKIIFQKEGNYGNNWNYGQVTLNETYDFKVIFDAFKKPGQSEIALDD
ISLTKGKCDESNYVEPTAIPTVTTLPSVPTDCGGPVELWEPNSTFSSENFPNNYPNQASC
VWYLNAEKGKNIQLHFQVFDLENIYDVVEVRDGRGSNSLLLAVYTGQDPLPDVFSTTNQM
TVIFLTDKSTTKKGFLANFTTGYNLGACAADEHQCGSGECIPLHNLCDNIPQCEDGSDEA
KCMRLLNGSLYTEGLVQARIGKTWYLACADDWNENISDSVCQMLGLGNGNMSSTVLFTGD
GPFVHISKAANDSLIFLKREHCLNNLVVHLQCNIKPCGKHLITQNNRTRIVGGSDARREA
WPWIVSLHFNSRPVCGASLVSDGWLVTAAHCVYGRQLKPSQWKAVLGLYDQLDMTQASTV
VRNIDQIVINPHYMKNTKDSDIALMHLQDKVQYTDYIQPICLPEKNQQFLPGINCSIAGW
GTITQGGPTSNVLQEAEVPLISNEKCQQLMPEYNITENMICAGHDAGGVDSCQGDSGGPL
TFEDGNKWVLIGVTSFGYGCALPKRPGVYVRVTMFVDWIGKIIY
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgtaacttcatcagatcccgtgagtctaactacaagccccttgacaccaact
ccaggttcaggacaactcaccacaagcaggtcctcaacaactgcagattctgtgagtcta
actacaagccccttgacaccaacttcaggttcaggacaacacaccacaagcaagacctca
acagctgcaggcattagaagctatttattttgtgatggagtctcggactgcccagatggt
tcagatgaatctgaagaaagatgtgcttcagtttgtgatggaaaattcatgttgactgat
tcctctgggttttttcactctatgaattatccaaagccatataatgaaaatataatttgc
cagtggattatactagtgcctcaagggttgtccattaaactgaacttcacctctttcgat
acacaacaatatgtggacattttagatatttttgaaggtataggacaaaccaaaatttta
agagcttctctgtcagggattaatcctgaaacaatttacattttttctcatgaagctaca
gcacaattcgtatctgattattctgaaaatcacgatggctttaacgcaatgtacactgca
tttaatgcaagtgaactaaacaattatgaaaaaatcaattgcacttttgaagatggcctt
tgctactggatacaagatttagatgatgattcagactgggagagagttcagggacccaac
tttccttttatgagtggtcctgattttgatcatacacttggcaatgagtcaggattttat
atttcaacacccataggtattggattcataggagagagagtccggattcggagtttgcct
ttggtgtctccagatccatcttgtctaagcttttggtatttcatgtacagtcctaacgtt
taccgtttaagagttatcataagtaatgagcatggctcggaaaagatcattttccagaaa
gaaggcaactatggaaacaactggaattatggacaagtaactttaaatgaaacatatgat
tttaaggttatatttgatgcctttaaaaagcctggtcaaagcgaaattgcattggatgac
attagcctgacaaagggaaagtgtgatgaaagtaattatgtagagccaactgcgattcca
actgttactactctcccttcagttcctactgactgtggagggccagtcgaactctgggag
ccaaacagtacattcagttctgagaactttccaaataattaccctaatcaagcttcttgt
gtgtggtatttaaatgctgaaaagggaaaaaacattcaacttcattttcaggtttttgat
ctggaaaatatttatgatgtagttgaagtcagagacggcagaggatcaaattccttactt
ttggctgtttatacaggacaagacccgttgccagatgtcttttctacaacaaaccagatg
acagtaatcttccttacagacaagtccacaacaaaaaagggatttcttgcaaacttcact
actggctacaatctaggagcttgtgcagctgatgaacatcagtgtggtagtggggagtgt
atacccttgcacaacctttgtgacaacatacctcagtgtgaagatgggtctgatgaagca
aagtgcatgagattgcttaatggttctctatacaccgaagggctggtacaggccaggatt
gggaagacatggtacctggcatgtgcagatgattggaatgaaaatatttcagacagtgtt
tgccagatgctggggttagggaatggaaatatgtcatcaactgtattattcactggagat
ggcccatttgtccacatcagcaaagcagctaacgacagcctaatatttctaaaaagagaa
cactgtttgaacaacctggtggttcatttgcaatgtaacattaaaccttgtggaaaacat
ctgataacacagaacaatcgaacaaggattgtaggtggaagtgatgccagaagagaggct
tggccttggatagtttcactccactttaattccagacctgtctgtggagcttcccttgtc
agtgatggatggctggtgactgcagcacactgtgtatatgggaggcaattaaaaccatct
caatggaaagcagttcttggcttgtatgaccaattagatatgacacaagcttcaacagta
gttcgaaacattgatcaaatagttataaatcctcattacatgaagaatacaaaagatagt
gatattgctctcatgcaccttcaagacaaagtgcaatatacagattacatacaacctatt
tgcttaccagaaaaaaatcaacagtttttaccgggaattaattgctccattgctggctgg
ggtactattacccaaggaggtcccacttcaaatgtattgcaagaagcagaagtccctctc
atttcaaatgaaaaatgccaacaattgatgccagaatataatatcacggagaatatgata
tgtgcgggacacgacgcaggaggagtagattcctgtcagggagattcaggtggccctctg
acatttgaagatggtaacaagtgggttttgattggtgtaacatcatttggctatgggtgt
gcccttcccaagcgaccaggagtatatgttcgagtcaccatgtttgtggactggatcgga
aaaataatctattag

DBGET integrated database retrieval system