KEGG   Columba livia (rock pigeon): 102095138Help
Entry
102095138         CDS       T02912                                 

Gene name
CMTR1
Definition
(RefSeq) cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
  KO
K14589  cap1 methyltransferase [EC:2.1.1.57]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:clv03019]
    102095138 (CMTR1)
Enzymes [BR:clv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.57  methyltransferase cap1
     102095138 (CMTR1)
Messenger RNA biogenesis [BR:clv03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     102095138 (CMTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsJ G-patch WW mRNA_cap_enzyme DNA_ligase_A_M G-patch_2
Motif
Other DBs
NCBI-GeneID: 102095138
NCBI-ProteinID: XP_013222881
UniProt: A0A2I0MAL0
Position
Unknown
AA seq 843 aa AA seqDB search
MFTKCDHLLSAKMKRRTEPEFGSPQKKQKKKIEDLGLTLSSTSDDETQFSNHTTQESSSS
SSASDSENDEKRPVFSNEFKQDSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYGQG
RKDIVEASNQKGRRGFGLTLKGFDGELNIDWQDEPEPSAYEEVDWCLECTTEIPDAQELK
EWMTVGKRKMVIEDETEFCSEEILHNVLQCKSVFDELDGEEMRRARTRSNPYEMIRGVFF
LNRAAMKMANMDHVFDYMFTNPKDFHGRPLIKERDAELLYFADVCAGPGGFSEYVLWRRK
WHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENITAFRNFVLDN
TDHKGVHFLMADGGFSVEGQENLQEILSKQLMLCQFLTALSIVRTGGHFVCKTFDLFTPF
SVGLIYLLYCCFERVCIFKPVTSRPANSERYVICKGLKLGIDDVRDYLFMVNIRLNQLRN
TDVDVNLVVPLNVIKGDQDFYDYIVHSNESHCKVQIKALAKIRAFVQDTTLIEPRQAEIR
KECLQLWGIPDQARVAPSSSDPKSKFFELIQGTDIDTFSYKPTPLNPSTLEKIRQVLDYR
CMVAGSEQKFLLGLGKSQIYTWDGRQSDRWTKLDLKTELPRDTLLSVEIVHELKGEGKAQ
RKISAIHILDVLVLNGNDVRKQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEM
EKIFVRLEMKIIKSSGGIPRLSYTGRDDRHFVPTGLYIIRTVNDPWTMAYSKNSKRKFFF
NKMTKAATYDLPSESIAPFHICHYSRLFWEWGEGVKVHDSQKRQDPEKLSKEDVLSFIQA
HYP
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccaaatgcgatcaccttctttcagcaaaaatgaagagaaggacagaacctgaa
tttggcagccctcaaaagaagcagaagaagaagatagaagacttgggattaaccctcagt
tcaacttcagatgatgaaactcaatttagtaatcatactactcaagagtcttccagtagc
agcagtgcgtctgacagtgagaatgatgaaaaaagaccagtcttcagcaatgagttcaaa
caagactctcttgtggagggtacttcatctcgctactcaatgtataacagtgtttcccaa
aagctcatggccaagatgggcttccgggaaggagaaggtctgggaaaatatggccagggc
aggaaggatattgttgaggcctccaatcagaagggaaggagaggctttgggctgaccctc
aaaggatttgatggggagctcaatattgattggcaggatgagccagagcccagtgcctac
gaggaggtggactggtgtttggagtgtaccacagaaatccctgatgcccaggagctgaag
gagtggatgactgtggggaagaggaagatggtgattgaagatgaaaccgagttctgtagt
gaagagattttacataatgtcctgcagtgcaagagtgtatttgatgagctggatggagaa
gaaatgcgtcgagcccgaacaaggtctaacccctatgagatgatccggggagttttcttc
ctgaacagggctgcgatgaagatggcaaatatggaccatgtctttgactacatgtttaca
aaccctaaggacttccatgggaggcccttgataaaggagcgagatgcagagctgctctac
tttgctgatgtgtgtgctggtcctggaggcttctctgaatatgtcttgtggaggcggaag
tggcatgcaaagggatttggcatgacgttgaaaggaccaaatgattttaaactagaggac
ttctattctgcttccagtgagctctttgagccttattatggagagggagggattgatgga
gatggagacatcactcgcccagagaacattactgctttccggaattttgttctggacaat
actgatcacaagggagtgcatttcttaatggctgacgggggtttctcagtggagggtcag
gagaatctgcaagaaatcctaagcaaacagctcatgctttgccagttccttacagcactg
tccatagtccggacaggaggacattttgtctgcaaaacctttgacctgtttactccattc
agtgtgggactcatctatctgctgtattgctgctttgagcgagtgtgcatcttcaaacct
gtgacaagccgccctgctaattcagagaggtatgtgatatgcaaaggattaaagctgggg
attgatgatgtgcgggactatctcttcatggtgaacatcagactcaatcagctgcgcaac
actgatgtggacgtgaatcttgttgtcccattgaatgtgatcaaaggcgaccaggatttc
tatgattacattgtccattccaatgaaagccactgcaaagttcagataaaggcactagcc
aaaattcgtgcctttgttcaagacacgacgctgattgagccacggcaggctgaaatccga
aaagagtgtctccagctatgggggattcctgatcaggctcgtgttgctccttcatcttca
gatcccaagtccaagttctttgagttaatccagggcacagacattgataccttcagctac
aaacccactcctctgaatcctagtacactggagaaaattcgccaagtgttagattaccgg
tgtatggtggctggaagtgagcagaagttcctcttgggactagggaaatcacagatctac
acctgggatggacgccagtcagatcgctggacaaagctggatttgaaaaccgagctgcca
cgagatacccttctctctgtggagattgttcatgagctgaaaggagaggggaaagcccag
agaaaaatcagcgccatccacatcctggatgtcttggtactgaacggcaatgacgttcga
aagcagcatttcaaccagaggattcagctggcagagaagtttgtcaaagctgtttctaaa
cctagccggccagatatgaaccccatccgagtgaaggaagtgtacagactggaagaaatg
gagaagatttttgtgaggttagagatgaaaatcatcaagagctcaggaggaataccccgg
ctgtcctacactggccgagatgaccggcactttgtacccacaggactctacatcatacgg
accgtgaatgatccctggacaatggcgtacagcaaaaactccaagaggaaattcttcttc
aacaaaatgaccaaggcagcaacatatgacctcccttctgaatccattgcaccctttcac
atctgccattacagccgtctcttctgggagtggggggaaggtgtcaaagtgcacgactct
cagaaaaggcaagatccagagaagctatcaaaggaggatgtcctgtctttcatccaagcg
cactacccctaa

DBGET integrated database retrieval system