KEGG   Columba livia (rock pigeon): 102095530Help
Entry
102095530         CDS       T02912                                 

Gene name
ALDH4A1
Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00250  Alanine, aspartate and glutamate metabolism
clv00330  Arginine and proline metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102095530 (ALDH4A1)
   00330 Arginine and proline metabolism
    102095530 (ALDH4A1)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     102095530 (ALDH4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102095530
NCBI-ProteinID: XP_021150944
Position
Unknown
AA seq 569 aa AA seqDB search
NNKTRYWSWGAERRRKTRRISVSVSRRWRWQHHAAIEVTNEPILEFKPGSPERAALQKAL
ADLKGKTEAIPCVIGGEEVWTPNVRYQLSPFNRAHKVAKYCYADKELINKAINAALAARK
EWDLKPVQDRAQIFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNA
KYALELESNQPISVDVSTNSMVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKP
SDTAVLSNYAVYKVLLEAGLPPNVVQFVLADGPVFGDTVTRSEHFCGLNFTGSVLTFKRL
WKQVSENLDHYRNFPRLAGECGGKNFHLVHSSADVSSVVNGTLRSAFEYGGQKCSACSRL
YAPDSLWPQIKEKLLEEHGKIKVGDPAQDFGTFFSAVIDDKSFARVKRWLEHAKKSPNLT
ILAGGGCDDSVGYFVDPCIVESKDPQDPIMKEEIFGPILTVYVYPEKRYQEVLDLIDTTS
PYGLTGAIFAQEKPIIAQARSRLRNAAGXXHIWASPSASVSCSPLFLFSFGTGTNDKPGG
PHYILRWTSPQAIKETHVPLTDWRYAYMQ
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
aacaataaaacacgttattggagctggggtgcggagagaaggaggaaaacaaggaggatt
tcagtgtctgtctctcgcaggtggcgatggcagcaccacgcggccatcgaggtgaccaac
gagcccatcctcgagtttaagccggggagccccgagcgagcagcacttcagaaggcgctt
gccgacctgaaaggcaagacagaagccatcccctgcgtgatcgggggcgaagaggtgtgg
acaccgaatgtgcggtaccagctgtcgccatttaaccgtgcgcacaaggtggccaagtac
tgctatgccgacaaggagctcattaacaaagccattaacgctgccttggcggccaggaaa
gaatgggacctgaaacctgtccaggaccgagcccagatcttcctgaaagcagccgacatg
ctgagcggccccaggcgagcggaggtgctggccaaaaccatggttgggcagggtaaaaca
gtgatccaggcagaaatcgatgccgctgccgagctgatcgacttcttccgattcaatgcc
aagtatgcgctggagctggagagcaaccagcccatcagcgtggacgtcagcaccaacagc
atggtgtaccgggggctggagggtttcgtggcggccatctcgcccttcaacttcacagcg
atcggtggcaacctggccggagctccggcattgatgggaaacgtggtcctgtggaagccc
agcgacaccgccgtgctctccaactacgccgtctacaaggtcctgctggaagccgggctc
cctcccaacgtcgtgcagttcgtgctggcggacgggcccgtcttcggagacaccgtcacc
agatccgagcacttctgcgggctcaatttcaccggcagcgtcctgactttcaagcggctc
tggaagcaggtatccgaaaacctggatcactaccgcaatttcccacgcctggccggagag
tgcggcgggaagaatttccacctggtgcacagctcagccgacgtgtccagcgtagtgaac
gggaccctgcgctcggccttcgagtacggcggccagaaatgctcggcttgctctcgtctc
tacgccccggactcgctgtggccccagatcaaagagaagctgctggaggagcacgggaag
atcaaagtgggagaccccgcccaggactttgggacgtttttctcggcggtgattgatgac
aagtcttttgcacgggtcaagagatggctcgagcacgctaagaagtcgcccaacctcacc
atcctggcgggaggcggctgcgacgacagcgtcgggtatttcgtcgatccctgcatcgtg
gagagcaaagacccgcaggatcccatcatgaaagaggagatttttggccccatcctcacg
gtttacgtctacccggagaagcggtaccaggaggtgctggatctcatcgacaccacgtcg
ccctacggcctcacgggggcaatcttcgcccaggagaagccgatcatcgcccaggcccgg
agccgcctgcgcaacgcggccgggnnnngccacatctgggcaagtccctcggcctccgtg
tcgtgctcaccgctgtttcttttctcctttggcacaggcactaacgacaaacctgggggt
ccccactacatcctgcgctggacgtcgccccaggccatcaaagagacgcacgtgccgctg
accgactggcgctacgcgtacatgcagtga

DBGET integrated database retrieval system