KEGG   Columba livia (rock pigeon): 102095835
Entry
102095835         CDS       T02912                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:clv03000]
    102095835 (AHRR)
Transcription factors [BR:clv03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102095835 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 Herpes_U5 PAS_4
Other DBs
NCBI-GeneID: 102095835
NCBI-ProteinID: XP_005508453
UniProt: A0A2I0MX35
Position
Unknown
AA seq 768 aa
MGSAMSIRTMIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLL
PFPPDIISKLDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQIIKEDNASNNTAVQEGG
LLLESLNGFALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHW
AMNPPQMLSGQQLQTETGEEHILSKLFKAQENDSTTTDYSSFLTRCFICRVRCLLDSTSG
FLTMQFQGKLKFLFGQKKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKA
DDAAAANTNSSSKGSSGLCEAAESYGRNSHHEGAAFTNMLQIAENQIKAKNNGENGISLV
KVQTNEDHWVWVQANTQFLYRSGCSEYVLAQQQMLKEEDEQLKVPSGFASLKGSVEGLSY
NSAIETLGQWKHLNWTGVKNEQDNVKVKLEPHTNGECFMPEEPLSSNTSHLGVQNNCTTN
SSWTLRNSSSCPMSQRLNACSNRRAGSFYNRDQSFLNLASTCPSHWGSTESCQSYSGAQQ
RCAENYATDHLKLQRPFVSSEPLYDAPFPLEMPIKTEHDSDSENIADNYLTSQNRAWLDE
NGSVRKPGFSYPNRVNLKTEPDLCEPASLCQKPRHCLYTPHNWQCIVANHPNNLNLNRSC
KGSRSKEVAPFCPQNSSGCLESLPDLLHTTCYSHFYSPSPGEEKEQNNEVFKMPWEFKNP
CLVQAIKREPLDSPPLSNSGQNRVHVSFPENTFAGPVPHKTTECTFLQ
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgggttcagccatgagcatcagaacaatgattcctccaggggaatgcctatatgctggg
aggaaaaggaggaaacccattcagaaacaaaggcctgcagttgggaatgaaaaatcaaat
ccttcgaagagacacagggaccgtctaaatgctgaactggaccatctggccagcctcctg
ccttttccacctgacatcatatcgaagctggacaaactttccgtcttgcgcctcagtgtc
agctatctccgagtcaaaagtttctttcaagccattcaagaaaagcactttaagaagcaa
gttggccaaataataaaagaagacaatgcgtctaacaacactgctgtacaagaaggtgga
cttctactagaatcactgaacggttttgcgttggtggtgagcgcagatggaatgatattt
tatgcatcatcaacgattgtggactatctagggtttcatcagactgatgtaatgcaccaa
aacatatatgattacattcatgtggatgatcgccaggatttctgtagacaactgcactgg
gccatgaatcctccccagatgttgtctggacagcaactacagacagaaacaggagaagaa
catattctcagcaaattgtttaaagcacaagagaatgacagcacgacaacagattattct
tccttcttaactcgttgtttcatctgccgagttcgctgcttgttggacagtacttctggc
ttccttacgatgcagttccaaggcaaactaaagtttctttttggacaaaagaagaagtcc
tcatcaggaacagtgttgccacctcagctgtccttattctgcatagtggtaccacttctg
ctcccttctgtgacagaaatgaagatgaaaagcctgcttgtgaaagcaaaacacaaagct
gatgatgcagcagcagcgaatacaaactccagttccaaaggtagttcaggcctctgtgaa
gcagcagaatcatatggaagaaacagtcaccatgaaggtgcagctttcaccaacatgtta
cagattgctgaaaaccaaatcaaagcaaagaataacggagaaaatggcatttctttagtc
aaagtacaaacaaacgaagatcactgggtctgggttcaagctaacactcaatttctctac
cgaagtggttgttcagagtatgtccttgctcaacagcaaatgttgaaggaagaagatgaa
caactgaaggtaccaagtggttttgccagtttgaaaggaagcgtggagggactttcttat
aacagtgccattgaaactctgggccagtggaagcatcttaactggacaggagtaaaaaac
gaacaagacaatgtaaaagtgaagcttgagcctcacacaaacggtgagtgttttatgcca
gaggaacctctcagttctaacacatcacatttaggcgttcaaaacaactgcaccacaaac
agcagctggactttaagaaactcaagctcttgtcctatgagccagcgactgaacgcatgt
tcaaacaggagagctggatcattctacaacagagaccaaagcttcttaaatttagcatca
acctgcccttcccactgggggagcacagagagctgccagtcttactcaggtgcccaacag
cgttgtgccgagaactatgcgacggaccatctgaaactgcagaggccgttcgtatcctcg
gagcctctctatgatgcaccctttcccttggagatgcctatcaaaaccgaacatgattct
gattctgaaaatattgctgataactacctgacgtcgcaaaaccgagcctggctggatgag
aacggctcagtgagaaagccggggtttagctaccccaatagagtgaacctcaaaacagaa
ccagacctctgtgagccagcctcactttgtcagaaaccacggcactgcctttacacgcca
cataactggcaatgcatcgtggcgaatcatcccaacaacctaaacctgaacagatcttgc
aagggttcacgtagcaaggaggtggccccgttttgccctcagaactcctccgggtgtttg
gaaagcttgcctgacctgctgcacacgacgtgctacagccacttctacagccccagtccg
ggggaggagaaagagcagaataatgaggtttttaaaatgccctgggaatttaaaaacccc
tgcttggttcaagcaatcaagcgtgagcccctggattctccaccgttgtccaacagcgga
cagaacagagtacacgtgagcttccccgaaaatacatttgcaggtcctgtgcctcataaa
accactgaatgtacatttttacaatag

DBGET integrated database retrieval system