KEGG   Columba livia (rock pigeon): 102096030Help
Entry
102096030         CDS       T02912                                 

Gene name
HEXB
Definition
(RefSeq) beta-hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00511  Other glycan degradation
clv00520  Amino sugar and nucleotide sugar metabolism
clv00531  Glycosaminoglycan degradation
clv00603  Glycosphingolipid biosynthesis - globo and isoglobo series
clv00604  Glycosphingolipid biosynthesis - ganglio series
clv01100  Metabolic pathways
clv04142  Lysosome
Module
clv_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102096030 (HEXB)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    102096030 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    102096030 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    102096030 (HEXB)
   00511 Other glycan degradation
    102096030 (HEXB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102096030 (HEXB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:clv03110]
    102096030 (HEXB)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     102096030 (HEXB)
Chaperones and folding catalysts [BR:clv03110]
 Intramolecular chaperones
  Others
   102096030 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 102096030
NCBI-ProteinID: XP_021156010
Position
Unknown
AA seq 448 aa AA seqDB search
HRRLCFPGRYYEYMFGQSLRRNWGYRPFGPRAEAELSHLQVVIESRDPGCDSHPHLGSSE
AYQLTVIAPVATLKADEVWGALRGLETFSQLVHEDDYGSFLVNESEIYDFPRFAHRGILL
DTSRHYLPLKSILTNLDAMAFNKFNVLHWHIVDDQSFPYQSICFPELSDKGAYSYNHIYT
PTDVRLVIEYARLRGIRVIPEFDTPGHTQSWGKGQKYLLTPCYNGEKPSGSFGPVNPILN
TTYDFMTKFFKEISSVFPDAYIHLGGDEVDFNCWKSNPEVQEFMKKQGLGRDYAKLESYY
IQKILDIVSSYNKGYMVWQEVFDNKAKLKPDTVVEVWMERNYAYELSNVTGAGFTAILAA
PWYLDYISYGQDWRKYYSVEPLNFSGSEKQKELLIGGEACLWGEFVDATNLTPRLCRRLT
NHRCRMLRRGIAAEPVFVGYCAHEARGQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
caccggcgtctgtgcttccccggcaggtactacgagtacatgttcggacagtccctccgg
cggaattggggctacaggccgttcggcccccgggcggaggccgagctgtcgcacctgcag
gtggtgatcgagtcccgggaccccggctgtgacagccacccgcacctcggctccagcgag
gcctatcagttaactgtaattgcgccggtggctacactgaaagcagatgaggtatggggc
gctttaagaggtttggaaacctttagccagttggttcatgaagatgactatggaagtttc
cttgtcaatgaatctgaaatctatgacttcccaagatttgctcatagaggaatcttactg
gacacttcaagacattatttaccgttgaaatctattcttacaaacctggatgccatggct
tttaacaagttcaatgttctccactggcatatagtagatgatcagtcattcccctaccag
agtatttgtttcccagagttaagtgacaagggagcatactcatataaccacatctatact
cctactgacgtccgtctggtgattgagtatgcccggttaagaggcattagagttatccca
gagtttgataccccaggacacacacagtcttggggaaaaggtcaaaaatatcttctcacc
ccttgttacaatggagaaaagccaagtgggtcctttggacctgtaaatcccattttgaat
acaacttacgacttcatgactaaattcttcaaagagatcagcagtgtgtttccagatgca
tacattcatttgggaggagatgaagtggacttcaattgttggaaatctaatcctgaagtg
caggagttcatgaagaagcaaggacttggcagagactatgctaaactggaatcttactat
attcagaagattttggacattgtttcctcctataacaaaggatacatggtttggcaagaa
gtgtttgataacaaagcgaagctgaaaccagatacggtagtcgaagtgtggatggaaaga
aactacgcttatgaactgagtaatgtcactggagctgggttcactgctatcctggcagct
ccctggtacttagactacattagttacgggcaagactggaggaaatactacagtgttgaa
ccgcttaacttctctgggtctgaaaaacagaaagagcttttaataggtggagaagcctgc
ctgtggggggaatttgtggatgcaactaacctcacaccaagattatgtagaagactgaca
aatcatcgatgccgcatgctccgccgtggcatagcagccgaacccgtgtttgttggatac
tgtgcccatgaagcaagagggcagtaa

DBGET integrated database retrieval system