KEGG   Columba livia (rock pigeon): 102096762
Entry
102096762         CDS       T02912                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102096762 (ADAMTS13)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102096762 (ADAMTS13)
Peptidases and inhibitors [BR:clv01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102096762 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 Reprolysin TSP_1 ADAM_spacer1 TSP1_CCN Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin Reprolysin_2 Peptidase_M10 CUB Peptidase_M66
Other DBs
NCBI-GeneID: 102096762
NCBI-ProteinID: XP_013226054
Position
Unknown
AA seq 1264 aa
MIVSLTLRALVMLPLGFCWPSAFQEKFLGALDAEDVFSYFGTSSVSDVPEFVVAEPTCPC
KEEQNGLASCRVQHCSIEAWGELYAFEFLEDHALLSSSFVSKQVVNSSFDLLKRFSGNCF
AGGNSLQPPGAKCRVTYCEGQLQGVVIADEEKIHIRPVRSKDLALLKDLGFFRPHILFRC
ATREGNTARAGRFPSRLQKRAEGAVKHLELMVVAGPDVYLYHKEDTERYILANLNIGAEL
LRDASLGAHFRVHLMQMLVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADI
VLYITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGITIAHEIGHSLGIPH
DGEGNRCSSSGYXXXXXXSIDLTWSQCSREEFLAFVSTGQTNCLNDLPDMDGSIPGWKPG
LYYGADEQCKIAFGSVATACTFADSNVDICEVLSCHVQPGDESSCARLLVPLLDGTECGI
NKWCSKGQCSSLEELNPMAVVHGQWSVWSPFSSCSRSCGGGVVLRQRFCNNPRXEPARWR
CPVADSGPWGLSPALCLGQTCLXACSVTEQDFMAEQCAATNLKPLYLTGEAPSFYNWTSA
VGFAKGDMLCKHMCRAMGNEFMVSRKGSFIDGTRCEQDESERRGAFNLCVTGTCRAFGCD
GQMDSKKIMDSCKVCGGDNTTCTKVSGSYTEGKAKEYVTFLSLPYNTTSVHVTNQRPLFT
HLAVKVKGEYAVAGKGKISQNVTYPSVLEDSQIIYKVFLTEDNLPSLEEIHVDGPTQEEI
EIQVYRRYAKEYGNATNPDITFSYFVPKENLTYVWIPQRGPCSVTCGEGERQLQYVCVAF
DTKEETQEENCRPVPKPESRMEICDLRPCPPRWKVTPAGPCSSSCGLGLAVQLVTCVQIH
QGKEMLLEERLCPVAEKPLTSVPCVIRMCSYEWSFSEWTECSTSCGNGIQTRQDFCLNPL
TRKQVNPVFCRHFPKAIVVRGCSAGPCPEQAMGTVSHGAGLQTVTPALPTTTTTAKEARY
KDLDLPPSAVPVVPEEQAETGGGVCGKLFLNATGVINMTGVESSDCTVAIGRPLGEEITL
RVLESSLNCSAGEIVLFSGRMMWRTGCRNLPLSLINSRTNTLIVKQRVSLPGNGVILQYN
SRTATKKYYQDCDKQLFGPHGEIANPVQLPVQRQEVVCRTFINVAPRHRVAIRALNIDLG
NESNQTHFNYILVRDVSTMKTMVFHGKQQFFWQSTGSQAEIEFHENVKDYQTSFWAEYYA
IEPK
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgatcgtcagcttgacgctccgggcgctcgtgatgctccccttggggttctgctggccg
tcggctttccaagagaaatttctcggcgctttggatgcagaagatgttttctcttatttt
ggaaccagctcagtgtctgatgtacctgagtttgttgttgctgagccaacttgcccttgt
aaagaagagcagaatgggctggcgtcctgtcgcgttcaacattgctccattgaggcctgg
ggagaactctacgcctttgaatttctcgaggaccatgccctcctttcctcttcctttgtg
agcaagcaagtggtgaactcttcctttgacttactgaagcgattctcgggcaactgcttt
gcaggtggaaattctctgcagcctcctggggcgaagtgtagagtcacatactgtgaaggg
cagctgcaaggagtcgtcattgcagatgaggaaaagattcatatcaggcctgtcagaagc
aaagatttggccctgctgaaggaccttggcttcttcagaccccacattctcttcagatgt
gccacaagagagggaaatacagcaagagcagggcggtttccttctcgcctgcagaagagg
gctgagggagctgtcaaacatctggagctgatggtcgtagcaggtccagatgtttacttg
taccacaaagaggacacggagcgatatattcttgccaacctgaacatcggggcagagctg
ctgagagacgcctcgctgggggctcatttcagggttcatcttatgcaaatgctggttttg
agagaaccagaggcagaggtgaacatcaccacaaatatcacctcctcgctgatcagcgtt
tgtgagtggagcaagaaggtcaatccccagaatgactctgacccccagcacgctgacatt
gtcctctacatcaccaggtttgacttggagttgcctgatgggaacaaggagctacgtgga
gtaactcagttagggggagtctgctcctccttctggagctgtgttattacccaggacacc
ggctttgaccttggaatcaccatagcccatgagattgggcacagtctgggaatcccccat
gacggtgaggggaaccggtgcagcagcagtgggtacnannnnnnnnnnnnnnnnagcatt
gacctcacctggtcgcagtgcagccgggaggagttcctggcctttgtcagcacaggccaa
acaaactgcttaaatgacctgccggacatggacggcagcatccctggatggaagcccggg
ttgtattacggagcagatgagcagtgtaaaatagcctttgggagcgttgccacagcgtgc
acctttgctgacagcaatgttgacatatgtgaagttctctcatgccacgtacaaccagga
gatgaatccagctgtgctcggcttcttgttcccctcttggatggtactgagtgtggaatc
aacaagtggtgctccaagggccagtgcagctctctggaagaactgaaccccatggctgtc
gtccatgggcagtggtcggtctggagccccttctcctcctgctcccgcagctgtggaggt
ggagttgtgctgcggcagcggttctgcaacaaccccaggtgagagccggcgagatggcgg
tgccccgtggctgattcagggccgtgggggctgagtcctgctctttgcttgggacaaacc
tgcctctgagcctgttcagtgaccgagcaggactttatggctgaacaatgtgcagcaaca
aacttaaagccactgtatctcactggagaagcaccatccttttataactggacttctgct
gttggctttgccaaaggggacatgctgtgcaagcacatgtgcagggccatgggaaacgaa
ttcatggtgagccgcaagggcagtttcatcgatggaacgagatgtgagcaggatgagtcc
gagcgccgcggggctttcaatctgtgtgtaacgggaacctgcagagcatttggctgtgat
ggccagatggactccaagaagataatggactcttgcaaggtctgtgggggtgataatacc
acttgcaccaaagtgagcggatcttacacagaaggaaaagctaaagagtacgttacattt
ctctccctgccttacaacaccacctctgtccatgttaccaatcagagaccactcttcaca
catttggctgtgaaggtgaaaggagagtatgcggtggctggaaaaggaaaaatctctcag
aatgtcacctacccgtcagttctggaagacagccagatcatatacaaagtgtttctcacc
gaggacaacctgccaagcctggaggaaatccatgtggatgggccaacgcaagaagaaatt
gaaatacaggtctatcgaaggtatgcaaaagaatacggcaatgccaccaacccagacatc
accttcagctactttgtccccaaagagaatctgacctatgtgtggattcctcagcgggga
ccgtgttcggtgacctgcggggaaggtgagaggcagctacagtatgtatgtgtggctttt
gacaccaaagaagaaacccaagaagaaaactgtcgtccagtgccaaagccggagagcagg
atggaaatctgcgatctcagaccctgcccgccaagatggaaggtaactccagctggcccc
tgttcctccagctgtgggctcggcttagctgttcagctggtcacctgtgtgcagattcac
caaggcaaggagatgttgctggaggagcgtttgtgtcctgtggcagagaagccccttacc
agtgtcccctgtgtcatccgaatgtgctcttatgaatggagctttagcgagtggacagag
tgttcaacttcgtgtgggaatggcatccagacacggcaggatttctgcctcaacccgctc
acccgtaagcaggtgaaccccgtcttctgcaggcacttccccaaggccattgtggtacgc
ggctgctccgcagggccctgtcctgagcaggcaatggggaccgtgtcccacggagcagga
ctgcagacggtgacaccagccctgccgacaacaaccacaactgccaaagaggcgagatac
aaggatctggatcttcctccatctgctgtgccagttgtgcctgaggagcaggcagagacc
ggtggaggtgtctgtggaaagctctttcttaatgccactggggtcatcaacatgacgggt
gtcgagagcagcgactgcaccgtggccatcggacgtccccttggggaggagataacgctc
cgtgtcctggagagctccctcaactgcagcgcaggtgagatagtgctgttttctgggcga
atgatgtggcggacgggctgcaggaacctccctttgtcactgataaattccagaacgaac
acactgattgtgaaacagcgcgtttcgctgccaggaaatggggtcattcttcagtacaac
agcagaactgcaactaaaaagtattaccaagactgtgacaagcagctgtttggtccccac
ggtgaaatagcgaatcctgtgcaattgcctgttcagagacaagaagtagtgtgtcggacc
ttcatcaacgtggctcctcggcatcgcgtcgctatccgtgccctaaatattgacttgggc
aatgagagcaaccagacacattttaattacatcctggtccgcgatgtaagcaccatgaag
acgatggtgttccatgggaaacaacaattcttctggcaatcaacaggaagccaagctgaa
attgaatttcatgagaatgttaaggattaccaaaccagtttctgggctgaatactatgct
attgagcccaaataa

DBGET integrated database retrieval system