KEGG   Columba livia (rock pigeon): 102097232Help
Entry
102097232         CDS       T02912                                 

Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04310  Wnt signaling pathway
clv04330  Notch signaling pathway
clv04350  TGF-beta signaling pathway
clv04520  Adherens junction
clv04916  Melanogenesis
clv05164  Influenza A
clv05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102097232
   04330 Notch signaling pathway
    102097232
   04350 TGF-beta signaling pathway
    102097232
   04068 FoxO signaling pathway
    102097232
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102097232
  Cellular community - eukaryotes
   04520 Adherens junction
    102097232
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102097232
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102097232
   05168 Herpes simplex infection
    102097232
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102097232
Transcription factors [BR:clv03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102097232
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102097232
Mitochondrial biogenesis [BR:clv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102097232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 102097232
NCBI-ProteinID: XP_021151489
Position
Unknown
AA seq 2198 aa AA seqDB search
MGMTGNTSPFGQPFSQTGGQQMGATGVNPQLPNKPGMANSLSPFPADIKSTPVTSVPNMS
QMQTQVQQVGIVPTQAMATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALP
HCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQ
PLLGSPAGGIQNSIGSVGTGQQNTPSLSNPNPIDPSSMQRAYAALGLPYGNQPQTQLQSQ
VQGQQPAQPQAHQQMRTINALGANQMNLPAGGITTDQQASLISDTALPTSLGTNNPLMND
GTNSGNVGNLSSMPTAAPPSSTGVRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDR
RMENLVAYARKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGMLGNQAA
LQTPGPQPPGIPAAAMGQAQPVRPPNGPMSMPTVPISRMQVSQGMNQFNPMSIGNVQMPQ
APMGPRAASPMNHPVQMNNMGAVPAMAMSPSRMPQPQNMMGAHGNNMMGQAPTQNQFLPQ
NQFPASSGAMNVNNVGMGQTTAQAGVAQGQVPSAALPNSMNMLGPQSGQLPCPPVTQPPL
HQTTPPVSTAAGMPPIQHQTPTGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPNATQTQ
STPTGQTAAQAQVTPQPQTPVQPQSVPTPQPSQQQPTSVQAQPPGTPFLQQLSQAAASID
NRVPTPASVASADTNSQQLGPDAPMLESKSEVKTEETEPETSETQVEAKTEVEEDLQGSS
QTKEETDGTELKQEPMEIEEKKPEIKVDAKEEEENSTNGTTSQSTSPSQPRKKIFKPEEL
RQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEP
WQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQT
LCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKK
KNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQ
TTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFP
YRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVY
HEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKA
FAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTA
ASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKE
VFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLC
MLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHDHKMVKWGLGLD
DESNSQGEQQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKR
KTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMA
TMNTRNVPQQSLPSPTSATPGTPTQQPSTPQTPQPPPQPQPSPVSMSPAGFPTVSRTQPP
TTVSTGKPANPVSAPPPPAQPPPAAVEAARQIEREAAQQQQQLYRVNNINNGLPPGRPGL
VNPTVGSVNQMQQVSMNVPRPNPVSGPVMSNMQPGQWQSPPMPQQQPMQPGMARPVMPMA
TPQAVAGPRMQGVQQPPRSIPPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIK
QRTAKYVANQPGMQPQAGIQPQPGMQQPQTGMQQPGMHAQAGLQNMNAMQAGVQRPSVPP
QQQGIGAMNPQGQAINIMNPSHNPSMANMSPQYREILRRQLLQQQQQQQQQQQGGAGMAG
GMAGHNQFQQPQGPGGYPQAMQQQRMQQHLSIQGGSMGQMAQMGQLNQMGQPGMGADGTP
NIQQALQQRILQQQQMKQQIGSPGQPNSMSPQQHMLSGQAPASHLPGQQITTSLSNQVRS
PAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSSMDQGHLGNPE
QSAMLPQLNTPNRSALSNELSLVGDTTGDTLEKFVEGL
NT seq 6597 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgacaggtaacactagtcccttcgggcagcctttcagtcaaaccggagggcag
cagatgggagctacgggagtgaatcctcagttaccgaacaagccaggcatggcgaatagc
ttgtctccctttcctgccgacatcaagagtactcccgtcaccagtgtgccaaacatgtcc
cagatgcaaacccaagtacagcaagtggggatcgtaccgacgcaggccatggccactgga
ccaacagcagatcccgagaagcgcaaactgatccagcagcagttggttctgctgcttcac
gctcacaaatgtcagcggcgcgagcaggcgaacggagaggtgcgggcctgcgccctcccg
cactgccgaaccatgaaaaacgtcctcaaccacatgacgcactgtcaggctgggaaggcc
tgtcaagttgctcattgtgcatcttcaagacaaatcatctctcactggaagaattgtact
cggcacgactgtcctgtttgccttcctttgaaaaacgccagtgacaaaagaaatcagcaa
ccccttttagggtctccagctggtggaatccagaattccatcggttcggttggcacgggc
cagcagaatactccatcgctgagcaatcccaaccccatcgaccccagctccatgcagcga
gcctacgctgcgctcgggttgccctacggcaaccagccccagacgcagctgcagtcccag
gtacaagggcaacagccggcacagccccaggctcaccagcaaatgaggaccattaatgca
ctgggagccaaccagatgaaccttcccgcaggaggaataacaacagaccagcaagctagt
ctaatttctgacactgctcttccaacatcccttgggacaaataacccactaatgaacgat
ggcacaaattctggcaatgttggaaacctcagttcaatgccaacggctgcacctccttct
agtaccggggtaaggaaagcatggcatgaacatgtcactcaggacctgcgcaatcattta
gtgcataaacttgtccaagccatctttcccactcctgatccagcagcactgaaggatcgc
cgcatggagaacttggtggcttatgccaggaaagtggaaggagatatgtacgaatctgct
aacagtagggatgaatactatcatttattagcagagaaaatctataagatacaaaaggag
ctagaagagaagcggcggtctcgcctccataaacaagggatgctggggaaccaggcggcc
ttgcagaccccagggccccagccccccgggatcccagctgcagccatgggccaggcacag
cccgtcaggccgcccaatgggcctatgtccatgccaaccgtgcctataagtcgtatgcag
gtttctcaaggaatgaatcagtttaaccccatgtccatagggaatgtacagatgccacaa
gcacccatgggaccccgtgcagcttctccaatgaaccatcctgtacagatgaacaacatg
ggcgctgttcctgcgatggcaatgtctccttcccgaatgcctcagccacagaacatgatg
ggagctcatggcaacaacatgatgggtcaggctcctacccagaaccagttcctgccccag
aaccagttcccagcatccagtggggccatgaatgtgaacaacgtaggcatgggtcagaca
acagcccaggccggggtggcacaggggcaggttcccagtgctgctcttcccaactccatg
aacatgctgggaccgcagagcgggcagttgccatgtccaccagtgacccagccacctcta
catcagactacacctcccgtgtccactgctgctgggatgccacctattcagcaccaaacg
ccaactggaatgactcctcctcagccagcagcacccactcagccatcaacacccgtctca
tcgtcgggacaaacaccaactccgacaccgggttccgttccgaacgcgacgcagacacaa
agcacgcccacggggcagactgcggcacaggctcaagtcacgcctcagcctcagacccct
gttcagccccagtctgtgccaaccccgcagccgtctcagcagcagccaacatctgtgcaa
gcgcagccacccggcactccatttttacaacagctatcccaggcagcagctagtattgat
aacagggtccccacccctgcctcagttgctagtgctgatacgaattcccagcaactagga
ccagatgcaccaatgctagaaagcaaatcagaagttaaaactgaagaaactgagccagag
actagtgagacacaagtggaagctaagactgaggtggaggaggatttacaagggtcttca
caaacaaaagaagaaacagatggaacagaactgaaacaggagccaatggaaatagaagaa
aagaagcctgaaataaaagtagatgctaaagaggaagaggagaacagcactaatggaacc
acttcacaatccacatcgccatctcagccacgcaaaaaaattttcaagcctgaggagctg
cgccaggctctcatgccgacccttgaagctttgtaccggcaggacccagagtctctacct
ttcagacagcccgtggatccccaacttctagggattccggattacttcgacattgtgaag
aatcctatggatctttcaaccattaagcgtaaattggatactgggcagtaccaagaaccc
tggcagtatgtggacgatgtttggctgatgtttaacaatgcctggctttacaatcgcaag
acttccagggtctataagttttgcactaaactcgcggaggtgtttgaacaagaaattgat
cctgttatgcaatcacttggctactgttgtgggcgcaagtatgagttttctccacagacc
ttgtgctgctacggcaagcagttgtgcacaattcctcgtgatgctgcctactacagttac
cagaataggtatcacttctgtgagaagtgtttcactgaaatccagggggagaatgtcacc
ctgggtgatgacccttcccagcctcaaacaaccatctctaaggatcagtttgaaaagaag
aaaaatgatacactagatccagagccgtttgttgactgcaaagagtgtggtcggaagatg
caccagatttgtgtattacattatgatattatctggccttcagggtttgtctgtgataat
tgtctgaagaaaactggtagaacacgcaaagaaaacaaattcagtgctaaaaggctgcag
accacgcgtttaggaaaccatttggaagacagagtaaacaaatttttgcggcgacagaat
catcctgaagctggagaggtctttgtcagagtagtagcaagttcagataagacagtagaa
gttaaaccaggaatgaaatccagatttgtggattctggtgagatgtcagaatctttccct
taccgtaccaaagccctgtttgcgtttgaggagatagacggagtagatgtttgcttcttt
ggcatgcacgtgcaggagtatggctcggattgcccccctccaaatacaaggcgtgtgtac
atatcatatctagatagtattcatttcttccgcccccgttgtctccgaactgcagtttat
catgaaatccttattggatatttggagtacgtgaagaaacttgggtatgtgacaggacac
atctgggcctgtcccccaagtgaaggagatgactatatttttcattgccatccacctgat
cagaaaatacccaaacccaaacgtttgcaagagtggtataagaagatgctggacaaggca
tttgcggagagaatcattcatgactacaaggacattttcaaacaagcaactgaggacagg
ctgacaagtgccaaggagctgccttacttcgaaggtgatttctggcccaatgtgctggaa
gaaagcattaaggagttggaacaggaggaggaggaaaggaagaaggaagaaagcactgca
gctagtgaaacaacagagggaagccagggcgacagcaaaaacgccaagaaaaagaacaac
aagaaaaccaacaagaataagagtagcatcagcagagctaacaagaagaaacccagcatg
ccaaatgtgtccaatgatctgtctcagaagctgtatgccactatggagaagcataaagag
gtcttttttgtgattcatttacatgctgggcctgtaattaacactctgcctcccatcgtg
gaccctgatccattacttagctgtgatttgatggatgggcgagatgccttcctcacctta
gccagagataagcactgggagttctcctcgctgcgtcgatccaagtggtccacgctctgc
atgctggtggaactgcacactcaagggcaggatcgctttgtctatacgtgcaatgagtgc
aaacatcatgtggaaacaaggtggcattgcactgtctgtgaggactatgacctctgcatt
aactgctacaacactaagagccatgaccacaagatggttaagtggggcctgggtctggat
gatgagagcaacagccaaggagagcaacagtcaaagagcccccaggagtcgcgacgactg
agcatccagcgctgcattcagtcccttgtccatgcctgccagtgccgcaatgcaaactgc
tcattgccatcctgccagaagatgaaacgggttgtccagcacaccaagggctgcaagcgc
aagaccaacggtggctgtccggtgtgcaaacagctcatagctctttgctgctaccatgcc
aaacactgccaagagaacaaatgccccgtgccattctgtctcaatatcaaacataagctt
cgacagcagcagatccagcatcgcctgcagcaggctcagctcatgcgcagaaggatggct
accatgaacacccgaaacgtgcctcagcaaagtttgccttctcctacctcagcaacgcct
ggtacccctacgcagcagccaagtacaccacaaacaccacagcctcctccccagccccag
ccttcccctgtaagtatgtcaccggctggctttcccactgtgtcaagaactcagccccct
actactgtttcaacaggaaaacctgcaaacccggtttctgcacctccacctccagctcag
cctcccccggccgcagtggaagcggctcggcagatcgagagagaagctgcccagcagcag
cagcagctctacagggtcaacaacattaacaatggtttgcctcctggtcgcccaggacta
gtaaacccgacagtgggttcagtgaaccagatgcagcaagtcagcatgaatgtaccccgg
cccaaccctgtcagcggtccagtgatgtccaacatgcagcctggacagtggcagtcccct
cccatgccgcagcagcaaccaatgcagccaggaatggcaagaccggtgatgccaatggca
acaccacaagccgtggctgggccaaggatgcagggtgtgcagcagccgccacggagcatc
cccccgaatgcacttcaggacttactgaggaccttgaaatcaccgagttctccgcagcag
caacagcaggttcttaatatccttaaatccaaccctcagcttatggcagcttttataaag
caaagaacagccaaatacgtggctaaccagcctgggatgcagccgcaagcaggcatacag
ccccagcctgggatgcagcagccgcagaccggaatgcagcagccgggcatgcacgctcaa
gcgggattgcagaacatgaacgcaatgcaagcaggagtgcagagaccgagcgtgcctccc
cagcagcaagggataggagctatgaatccccagggacaagcgataaacatcatgaacccc
agccacaaccctagcatggcaaacatgagtccgcagtacagagaaatcctgaggcggcaa
cttctgcagcagcagcagcaacagcaacagcagcagcaaggaggggctggcatggcagga
gggatggcaggacacaaccagttccagcagccccagggaccgggaggttaccctcaagcc
atgcagcagcagcggatgcagcagcatctctcgatacagggcggctccatgggacagatg
gctcagatgggacagctgaaccagatgggccagcccggcatgggggcggacggcaccccc
aacatccagcaagcgctgcagcagcgcatcctgcagcagcagcagatgaagcaacagata
gggtcccccgggcagcccaactccatgagcccgcagcagcacatgctctcaggacaagcg
ccggcgtctcatctccccggccagcagatcaccacctccctcagcaaccaggtgcggtcc
ccagcacccgttcagtctccccgtccccagtcccagccgccacattccagcccgtcaccc
aggatacagccccagccgtcacctcaccatgtctctccccagactggttccccccacccg
ggactcgcagttactatggctagtagctccatggatcagggacacttgggcaaccccgag
cagagtgcaatgcttccacaactaaacacccccaacaggagtgcgttgtctaacgaattg
tctctggtcggtgacaccaccggggacacactagaaaaatttgtggagggtttgtag

DBGET integrated database retrieval system