KEGG   Columba livia (rock pigeon): 102097361Help
Entry
102097361         CDS       T02912                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04270  Vascular smooth muscle contraction
clv04350  TGF-beta signaling pathway
clv04510  Focal adhesion
clv04530  Tight junction
clv04810  Regulation of actin cytoskeleton
clv05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102097361 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102097361 (ROCK1)
   04530 Tight junction
    102097361 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102097361 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102097361 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102097361 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102097361 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102097361 (ROCK1)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102097361 (ROCK1)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   102097361 (ROCK1)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102097361 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 102097361
NCBI-ProteinID: XP_013226078
UniProt: A0A2I0MW50
Position
Unknown
AA seq 1408 aa AA seqDB search
MSTGESFESRFEKIDVTLKDPKSEVNVDCLLDGLDALVYDLDFPALRKNKNIDNFLNRYK
DTVNKMRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLAVSAENSNDNRTGS
NVDKSVLENMQKMIYELEEQLHNEMQLKDEMEQKCRSSNIKLDKIMKELDEEXXXXXXXX
STVSQIEKEKMVLQHKLNDYQRKMEQENEKRRNAENEVSTLKDQMEDLKKISQHSQITNE
KITQLQKQLEEANDLLRTESDTAARLRKGNTEMSKSLSQVESLNRELQERCRVLESMKLQ
VEKDYYQLQAALESERRDRSHGSEMIGELQVRITTLQEEVKNIKNNLERVEAERKQAQDM
LNNSEKEKNNLEIDLNYKLKSLQDRLEQEVNEHKVTKARLTDKYQSIEEARSVAMCEMEK
KVKEERAAREKAENRIVQAEKQCSMLDFDLKQSQQKLEHLLEQKERLEDEVKNLTLQLEQ
ETNKRIMAQNELKTQAFEADNLKGSEKQLKQEINTLLEAKRLLEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNKETLRKMQELQNEKETFTTQLDLAETK
AESERLARALLEEQYFELSQESKKAASRHRQEMTDKDSIIRRLEETNNTLTKDVDLITKE
NSEISEKMKKQEEEYKMKKEEEINNIRTHYEKSLNTERTLKTQAVNKLAEIMNRKDFKID
RKKANMQDLRKKEKENRKLQLELNQEKEKFNQMVVKYQKELNEMQAQLAEESTYRNELQM
QLDSKESDIEQLRRKILDLQQGMDSTSVASLPSDETDGNLSESRLEGWLSIPNKGNIKRH
GWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVEPVQPTEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
AALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKKI
PKTPPSTFVRASPRTMSTRSSANQSFRKVVKNTSGKTRHRVWRKKHTELKPFREAQYLTS
RVLGMCVLLACGAAWRHVQEAGAAPTPC
NT seq 4227 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgggagaaagttttgagtctcggtttgaaaaaatcgacgtgactttgaaggac
cccaaatccgaagtgaacgtggactgtttgctggatggattagatgctttggtatatgac
ttggattttcctgccttaagaaaaaacaaaaacattgataacttcttaaacaggtataaa
gacacagtaaataaaatgagggatctgcgcatgaaagctgaagattatgaagtggtgaag
gtgattggtagaggggcatttggggaggttcagttggtaaggcataaatcctcaaggaga
gtgtatgctatgaagcttctgagcaaatttgagatgataaaaagatcagattctgcattc
ttctgggaagaaagggatattatggcttttgctaacagtccctgggttgttcagttattt
tacgcattccaagatgaccgttacctttacatggtgatggaatacatgcctggtggggac
cttgtgaatttaatgagcaactacgatgttccagagaaatgggcaagattttatactgct
gaagttgtacttgcgttagatgcaattcactcaatgggttttatacacagagatgtgaag
cctgataatatgctgctagataaagctggtcatttgaaactagcagattttggtacttgt
atgaagatgaacaaggaaggcatggtacgatgtgatactgctgtgggaacaccagactat
atctctcctgaagtactgaagtcccagggtggtgatggttactatgggcgagaatgcgac
tggtggtcagttggagtctttttgtatgagatgcttgtaggtgatacacctttttatgca
gattctttggttggaacatacagtaagattatgaaccataagaactcccttactttccct
gatgacaatgacatttctaaagaggcaaaaaaccttatttgtgcctttttaactgatagg
gaagtgaggctaggacgaaatggcgtagaagaaattaaacggcaccttttcttcaaaaat
gatcagtgggcttgggaaactctcagagatactgtagcaccggtggtgcctgacttaagt
agtgacattgacactagtaattttgatgatctggaagaagacaaaggagaagaagaaaca
tttcccataccaaaagcatttgtgggcaaccagcttccttttgtaggatttacgtactac
agcaaccgtcggtatttagctgtttctgcagaaaattccaatgataacagaacgggctcc
aatgtggataaaagtgtgctggaaaatatgcagaagatgatctatgaattggaagaacaa
ctacataatgaaatgcagttgaaagatgaaatggagcaaaagtgcagatcttcaaacata
aagctagacaagataatgaaagaactggatgaagagnnnnnnnnnnnnnnnnnnnnnnna
tcaacagtgtctcagattgagaaggaaaagatggtattgcaacataagctaaatgactac
caaagaaaaatggaacaagagaatgaaaaaagacggaatgcggaaaatgaagtgtctaca
ctaaaagatcagatggaagacttgaaaaaaatcagccaacattcacaaattacaaatgag
aagataacacaattacagaaacaactagaagaagcaaatgatttgctgaggacggaatcg
gatacagcagcaagactgagaaagggtaacacagaaatgagcaagtcactaagtcaggta
gaatcactgaacagagaactgcaggaaaggtgcagagttctagaaagcatgaaactgcag
gtggagaaagattattaccaactacaagcagctttggagtcagaacgaagggacagaagt
catggatctgaaatgattggagaactacaagttcggattacaactttacaagaagaagta
aaaaacatcaaaaacaatcttgaaagagtggaagcagaaagaaaacaagcacaagatatg
cttaataattcagaaaaggaaaagaataatttagagatagatttgaattacaaactcaaa
tcattacaagaccgattagaacaggaagtaaatgaacacaaagtgactaaagctcggtta
actgacaaatatcagtcaatagaggaggcaagatcggttgcaatgtgtgaaatggaaaaa
aaagtaaaggaagaaagggcagcaagagaaaaggcagaaaatagaatagttcaagctgaa
aaacagtgttctatgctggactttgacctgaagcaatcacagcagaaactagaacacctt
cttgagcaaaaggaaagactggaagatgaagtaaagaatctaacacttcagctagaacaa
gagacgaataagcgaataatggcacagaatgaattaaagacacaagcttttgaagcagat
aacttgaagggttctgaaaagcagctgaaacaggaaatcaatacattgttggaagcaaag
agattactggaatttgagttggctcaacttgctaaacagtacagaggaaatgaaggtcaa
atgcgtgagcttcaggatcaacttgaagctgagcagtatttttcgacactttacaaaact
caggttaaggaactgaaagaggaaattgaggaaaagaataaagaaactctaaggaaaatg
caggaattgcaaaatgaaaaagagactttcactacccagttggatttagctgaaaccaaa
gctgagtcagaacggttggcacgagccctccttgaagaacagtattttgaactgagtcag
gaaagcaaaaaagcagcatcaagacacaggcaagaaatgactgataaggacagcatcatc
agaaggctggaagaaactaataacacattaaccaaagatgttgatttaataacaaaggaa
aattcagagatcagtgaaaaaatgaagaaacaagaggaagaatacaaaatgaaaaaagag
gaggaaatcaataatattagaacgcattatgagaagagccttaacactgaaagaactctg
aagacacaggctgtcaacaaactggctgagataatgaatcggaaagattttaaaatagac
agaaagaaagctaacatgcaagatttgaggaagaaagaaaaggagaaccgaaagctccaa
ctagagctcaatcaagaaaaagagaaattcaatcagatggtagtgaagtaccaaaaggag
ctcaatgaaatgcaagcgcaactagcagaagaatctacatacaggaatgagctccagatg
cagctggatagtaaagagagtgacatagaacaactacgaaggaaaattttggacctccag
caaggaatggattctaccagtgttgctagtctcccgtcagatgaaacagatggaaatctt
tcagaatcaagacttgaaggttggctttcaataccaaacaaaggaaatataaagcggcat
ggctggaagaaacagtacgttgtggtaagcagtaaaaagatactgttctacaatgatgaa
aaggacaaggaccagtctaatccatccatggtactagatatagataagctcttccacgtc
cggcctgtaactcaaggagatgtatatagagctgaaactgaagaaattcctaaaatattc
cagattctctatgctaatgagggggaatgcaggaaggatttggaggtagaaccagtacaa
cccacagagaagacaaattttctaaaccacaagggccatgaatttattccaacattatac
cactttccagccaactgtgaggcctgtgccaaacctctttggcatgtctttaaaccccct
gctgccctagaatgtcgaagatgccacgtgaagtgccacagagaccacttggataaaaag
gaggaattaattgcaccatgcaaagtgagttatgatgtaacttcagcaagagatatgttg
ttattggcatcctgtcaagatgaacagaagaagtgggtaactcatttagtaaagaagatc
ccgaaaacaccaccgtctacttttgttcgtgcttctcctagaactatgtctacgagatcc
tcagcaaatcagtcattcagaaaagttgttaaaaatacttctggaaaaactaggcaccga
gtatggaggaagaagcatactgagcttaagccatttagagaggcacaatacttgaccagc
agagtgctaggtatgtgcgtgctgctggcctgtggtgctgcatggagacacgtgcaggag
gcaggtgcagcccccacgccttgctga

DBGET integrated database retrieval system