KEGG   Columba livia (rock pigeon): 102097779Help
Entry
102097779         CDS       T02912                                 

Gene name
NME7
Definition
(RefSeq) nucleoside diphosphate kinase 7 isoform X1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00230  Purine metabolism
clv00240  Pyrimidine metabolism
clv00983  Drug metabolism - other enzymes
clv01100  Metabolic pathways
Module
clv_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
clv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
clv_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102097779 (NME7)
   00240 Pyrimidine metabolism
    102097779 (NME7)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102097779 (NME7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102097779 (NME7)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     102097779 (NME7)
Membrane trafficking [BR:clv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102097779 (NME7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK DUF1126
Motif
Other DBs
NCBI-GeneID: 102097779
NCBI-ProteinID: XP_021155396
Position
Unknown
AA seq 382 aa AA seqDB search
MMLLTEQSQDDRFAFTAEWYDPNASLFRRYELLYYPKDGSVEMYDVKNHRTFLKRTKYES
LHLEDLFVGNKITVFSRHLSLVDYGDQYTARKLGSRKERTLALIKPDAVPKIGELIDIII
NAGFTITKAKMMVLSRKEAVDFYVDHQSKPYYNELLEFITSGPIVAMEILGDDAICKWKT
LLGPANSAVAKTDAPGSIRANYGHDGLRNAAHGPDSVASAAQELELFFPSSGGRGPVNSA
KFTNCTCCIIKPHAVNEGLAGKIINAIINEGFRISALQMFNMERTNVEEFFEIYKGVVAE
YVEMVTELCSGPCIAMEIIQPEPPKVFRDFCGPSDPEIARHLRPGTLRAVFGKNKIQNAV
HCTDLPEDGLLEVQYFFKILDN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttttaactgaacagagtcaagatgacagatttgctttcactgctgaatggtat
gatccaaatgcttcactctttcgacgttatgaacttctgtattatccaaaagatggatca
gttgaaatgtatgatgtgaagaaccatcgcacctttctgaagcgtaccaagtatgagagc
ttacaccttgaggatttatttgtgggcaataaaattactgttttttcccgtcatctgtcc
ttagtggactatggggatcaatatacagcccgcaagctggggagccgcaaagaaagaaca
ctggctttgattaaacctgatgcagtgcccaagattggagaattaattgatatcattatt
aatgcaggatttacaataactaaggccaaaatgatggtgctttcaagaaaagaagcagtt
gatttctacgtagaccatcaatcaaaaccttattataatgagcttctggagtttataacg
agtggtcccattgttgctatggaaatcttaggagatgatgcaatttgtaaatggaaaaca
ttattggggccagcaaactctgcagtggctaagactgatgcaccaggcagcattagagcg
aactatggacatgatggcctaagaaatgcagctcatggcccagattcagttgcttcagct
gctcaagagctggagttgttctttccctccagtggaggtcgcggaccagtcaacagtgca
aaattcacgaactgtacttgttgcattattaagcctcatgcagttaatgaagggctagct
ggaaagattataaatgccatcatcaatgagggatttcggatctcagcattgcagatgttc
aacatggagcgtacaaatgtggaagaattttttgagatttacaaaggtgttgtcgctgaa
tatgtggagatggtcacagagttgtgttcaggcccttgcatagcaatggagattatacaa
cccgagcctccaaaagtgttcagagacttctgtggtccttctgaccctgaaatagctcga
catctccgacctggaactctgcgtgctgtctttgggaagaacaagattcagaatgctgtc
cactgcacagacctacctgaagatggacttttggaggtacagtacttcttcaagattctg
gacaactaa

DBGET integrated database retrieval system