KEGG   Columba livia (rock pigeon): 102098663
Entry
102098663         CDS       T02912                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102098663 (AKAP5)
Protein phosphatases and associated proteins [BR:clv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102098663 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 102098663
NCBI-ProteinID: XP_021148493
Position
Unknown
AA seq 463 aa
MAKAAKEIQMENPREVETHSTGAMCSPSEEQAEKPSMLCFKKRKKSCKKGQSVNDACEGA
SEEKSQSISTDQGEAKVSNQSRSSKGAWAAIKNLTRPRRRQKSSSRKKVPSDSRVQLEVD
AEEGRAQGVPKKRVSSGVKMPCVRFSRSKKKLSPSEAVEDSEGSVQANEVMGILNKASEE
MEDLAPPDKSESFSPVSAEEDQETVKESVNSVGKSEPLEPTPDAEEHTECPAQSEVTESE
TVNETAREAPPEGTLPQNTVHAECGEAAPEAPVSKDQPDSTPETTELQEIPDACRELPEG
DESEKSVNLPEECKAEETVMDFSQSAFKDDVSVQGCSSQQVSLAASMGTGVGIVITVTEA
EDSDNTDSDQAYEPSPVLHHKKQRGNKKSSESFDFGTKEGPEAGGGPQAEEKGPGDHGHR
TGEQYELLLIETASSLVKAAIQSSIEQLVSEMALEQNKHNSFL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcgaaggcagctaaggaaattcaaatggagaacccaagagaggtagagactcacagc
acaggggcaatgtgttccccgtcagaggaacaggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaagggcagagcgtgaatgatgcgtgtgaaggagcc
tcggaggagaaaagccaaagtatcagcaccgaccaaggggaggccaaagtttctaatcaa
tcgcgatcctccaaaggagcctgggcagccatcaaaaacctcacaagacctcggagaagg
caaaaatcctcctcgcggaagaaggtgccctctgattcccgagtgcagctggaggtggat
gctgaggagggccgtgcacaaggcgtcccaaagaaacgggtcagctctggggtgaagatg
ccctgtgtacggttctccagaagcaagaaaaagctcagcccctctgaagccgtggaggat
tcggagggcagcgtgcaagcaaatgaggtgatgggcattttgaataaagctagtgaagag
atggaggatttggccccaccggataagtctgaatccttcagcccagtctctgcggaggag
gaccaggagacggtgaaggaaagcgtcaactctgttgggaagagcgagcccttagagccc
acacctgatgcagaggaacatacagagtgccccgctcagtcggaggtaactgagtcagag
acagttaatgaaacagcccgggaggcaccgccggaggggaccctgccccaaaacacagtc
catgcagaatgtggggaagctgctcccgaagcgcctgtttccaaggatcaacccgacagc
acccctgaaaccacggagctgcaggaaatccctgatgcctgcagagagctgcctgaaggg
gatgaatcagaaaagagtgtaaatcttcccgaggagtgcaaagccgaagaaactgtaatg
gatttcagtcagtcggcatttaaagatgatgtgagtgtgcagggctgctccagccagcag
gtgagtttagcagcaagcatgggcactggagttggcatcgtcatcactgtcaccgaagcc
gaggactctgacaacactgactctgaccaggcctacgagccatccccggttttgcaccac
aagaagcaaagagggaataaaaaatcaagcgagagctttgattttggtacaaaagagggc
cccgaggccggtggtggtccccaggcagaggagaaaggtccaggtgaccatgggcacaga
actggggagcagtacgaattgctcctcattgaaacggcatcttccctcgtgaaggcagcc
attcagtcatccatcgagcagctagtcagtgaaatggctctggaacagaataaacacaac
agttttctgtga

DBGET integrated database retrieval system