KEGG   Columba livia (rock pigeon): 102099022Help
Entry
102099022         CDS       T02912                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00010  Glycolysis / Gluconeogenesis
clv00562  Inositol phosphate metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102099022 (MINPP1)
   00562 Inositol phosphate metabolism
    102099022 (MINPP1)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102099022 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102099022 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 102099022
NCBI-ProteinID: XP_021146971
Position
Unknown
AA seq 334 aa AA seqDB search
MAPHRAAAAPCSSAALLLLSLLLAVASAGLSSYFGTKSRYEEVNPYLVQDPLSLGRPHLL
SEVEVQVNDALMRFFDYCAKFVALVEENDAAMCQVTAFKEGPEMRKVLEKVASALCLPVE
ELNADLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSR
SSCILFQDIFEHLDEAVEESKSSKPISSPLIVQVGHAETLQPLLALMGFFKDDEPLKANN
YIKQTHRKFRSGRIVPYAANLVFVLYHCDHAKTSDEEYQVQMLLNEQPLVFLHSNETVST
YADLRDYYKDILENCHFKEECELPKINVTAVDEL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcaccgggcagcagcggccccgtgttcctccgccgccctccttctcctgtcg
ctgcttctggcggtggcgagcgcgggcttgagcagctacttcggcactaagtcccgctac
gaggaggtgaacccgtacctggtgcaggacccgctgtcgctgggtcgcccgcatttgctt
tcagaggtggaggtccaagttaacgacgccttgatgcggtttttcgattactgcgccaag
tttgtagccttggtggaagagaacgacgcggcgatgtgccaggtgacagccttcaaagag
gggccggagatgaggaaagtcttggagaaggtggcgagtgccttgtgtttgccggtggag
gagctgaacgcagatcttgttcaagtggcttttctcacctgctcatatgagttggctata
aaaaatgtgacctccccttggtgttcactcttcagtgaagaagatgccaaggtgctggaa
tacctgaatgacctgaagcaatactggaagagaggatatggctatgacatcaacagtcgc
tccagctgcattttattccaagatatctttgagcatttggatgaagcagtggaagagagc
aaaagttcaaaacctatttcttcacctttgattgtacaagttggacatgcagagacactt
cagccactgctcgcccttatgggtttcttcaaagatgatgagcctctgaaggcaaacaat
tacatcaagcaaacgcatcggaaatttcgcagtggccggattgtgccttatgcagccaac
ctggtttttgtgctttaccactgtgatcacgcgaaaacctctgacgaagagtatcaagtg
cagatgctgttgaatgaacaaccgctggtgtttcttcactcgaatgaaaccgtctctact
tatgcggacctcagggactattacaaggacatcctggaaaactgccatttcaaagaagag
tgtgaattaccaaaaattaatgttactgctgttgatgaactttga

DBGET integrated database retrieval system