KEGG   Corynebacterium lactis: CLAC_02660Help
Entry
CLAC_02660        CDS       T04042                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
clw  Corynebacterium lactis
Pathway
clw00071  Fatty acid degradation
clw00072  Synthesis and degradation of ketone bodies
clw00280  Valine, leucine and isoleucine degradation
clw00310  Lysine degradation
clw00362  Benzoate degradation
clw00380  Tryptophan metabolism
clw00620  Pyruvate metabolism
clw00630  Glyoxylate and dicarboxylate metabolism
clw00640  Propanoate metabolism
clw00650  Butanoate metabolism
clw00900  Terpenoid backbone biosynthesis
clw01100  Metabolic pathways
clw01110  Biosynthesis of secondary metabolites
clw01120  Microbial metabolism in diverse environments
clw01130  Biosynthesis of antibiotics
clw01200  Carbon metabolism
clw01212  Fatty acid metabolism
clw02020  Two-component system
Module
clw_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:clw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLAC_02660
   00630 Glyoxylate and dicarboxylate metabolism
    CLAC_02660
   00640 Propanoate metabolism
    CLAC_02660
   00650 Butanoate metabolism
    CLAC_02660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLAC_02660
   00072 Synthesis and degradation of ketone bodies
    CLAC_02660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLAC_02660
   00310 Lysine degradation
    CLAC_02660
   00380 Tryptophan metabolism
    CLAC_02660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLAC_02660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLAC_02660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLAC_02660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clw04147]
    CLAC_02660
Enzymes [BR:clw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLAC_02660
Exosome [BR:clw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLAC_02660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ETF_alpha
Motif
Other DBs
NCBI-ProteinID: ALA66812
UniProt: A0A0K2GYF2
Position
627220..628428
Genome map
AA seq 402 aa AA seqDB search
MSNLPAPSPNDVVILAGARTPQGKLLGQLASLTAVDLGAHAIKNAVERAGVKPEDVQRVV
LGQVILAGAGQNPARQTAIKAGLPWNVTAEIVNKVCLSGLDAIIHATRMIRLGEADVIVA
GGQESMTNAPHVARGVRQGKSYGGLKLEDTLERDGLVDSFDGVSMGTLTDGPNGDLGITR
EQQDEVAAASHQRAAKAQADGIFAEEIAPLEIPQRKGDPVIVDADQGIRPETTVETLSKL
KAVFLKENGTITAGNSSPISDGAAAVVLASRAYAEKNGLDYLAVVGQAGQTAGPDNSLHA
QPSDSLKEALRRAEWDVQELDFIEINEAFGAVAVKSLRELDYPLEKTNIHGGAIALGHPI
GCSGARLAFTAAMELNRRGSGRAGVSLCGGGGQGDALLLYRD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccttcccgcccccagcccgaacgacgtcgttatcctcgctggcgcccgcacc
ccgcagggcaagctgctgggccaactggcatctctgaccgcggtcgacctcggcgcgcat
gccattaagaacgcagtcgagcgcgccggagtgaagccggaggatgtccagcgcgtagtt
ctcggtcaggttatcctcgccggagcggggcagaaccccgctcgtcagaccgccattaag
gccggcctgccgtggaacgtcaccgcagagatcgtgaataaggtctgtctttcaggactg
gacgcgattatccacgcaacacgcatgattcgcctgggtgaggccgacgtcatcgtcgcc
ggcggccaggaatccatgactaacgccccgcacgtcgctcgcggcgtccgtcagggcaag
tcctacggtggcctgaagctggaggacaccctcgagcgcgacggtctcgtcgactccttc
gatggcgtatccatgggcacgcttaccgacggtcctaacggcgacctcggcatcactcgc
gagcagcaggatgaggtcgcggccgcttctcaccagcgtgctgcaaaggcacaggccgat
ggcatcttcgctgaggagattgcgccgctggagattccgcagcgcaagggcgacccggtt
attgtcgatgccgatcagggtatccgcccggagaccaccgtcgagacgctgtcgaagctc
aaggccgtgttcctgaaggaaaacggcactatcaccgccggcaactcctcgccgatttcc
gacggcgcggcagccgtcgtcctcgcatcgcgtgcctacgcggaaaagaacgggctggac
tacctggcggtcgtcggccaggctggtcagaccgcgggcccggataactcgctgcatgct
cagccgtcggactccctgaaggaggccctgcgtcgcgcggagtgggatgttcaggagctc
gacttcatcgagattaacgaggcctttggtgcggttgctgtgaagtcgctgcgcgagctg
gactacccgctggagaaaaccaatatccacggtggcgcgattgctcttggccacccgatt
ggttgctccggggcgcgccttgcattcactgctgcgatggagctgaaccgtcgaggttcc
ggtcgcgcaggtgtgagcctgtgtggcggcggtggccagggtgatgccctgctgctgtac
cgcgactag

DBGET integrated database retrieval system