KEGG   Corynebacterium lactis: CLAC_04820Help
Entry
CLAC_04820        CDS       T04042                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
clw  Corynebacterium lactis
Pathway
clw00020  Citrate cycle (TCA cycle)
clw00620  Pyruvate metabolism
clw00650  Butanoate metabolism
clw01100  Metabolic pathways
clw01110  Biosynthesis of secondary metabolites
clw01120  Microbial metabolism in diverse environments
clw01130  Biosynthesis of antibiotics
clw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLAC_04820
   00620 Pyruvate metabolism
    CLAC_04820
   00650 Butanoate metabolism
    CLAC_04820
Enzymes [BR:clw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CLAC_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ALA67144
UniProt: A0A0K2GZC9
Position
complement(1093716..1095218)
Genome map
AA seq 500 aa AA seqDB search
MSDRIAHAGLRGKVMSADEAAQFINHGDSIGISGFTGAAYPKALPTALANRGKELHAAGK
EFKVNIYTGASTAPDCDGVMAEADIINYRMPYQGDPSLRKSINAGNAKYQDIHLSQSPQY
IEQGFLPIDAAIVEATRITEEGHIIPSSGIGNNVEYLDNADKIIIEVNSWQSLDLEGMAD
IYRIQRLPNRTPIPINAPGDRIGTPYIDINLDKVVAVVETNAPDRNAPFKPIDETSQQIA
GHFLDFLDGEVAAGRLAYDQYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVIQDGMLDL
IDAGKMTVASSTSFSLSPEAAEKMNNEAARYRKHIILRPQQISNHPEVVRRVGLIATNGM
IEADIYGNVNSTHINGSRVMNGIGGSGDFTRNAFISSFISPSLAKDGAISAVVPFVSHID
HTEHDAMVIITERGVADLRGLAPRDRVAKMISIAHPDYQPLLEEYYERALKKAPALATPH
DLRTAFDFHINMIEKGSMKG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgcacacgctggattgcgcggaaaagtaatgagcgccgacgaggca
gctcagttcattaaccacggagacagcatcggtatctccggcttcaccggcgctgcctat
cctaaggctctgcctaccgctctggcgaaccgaggcaaggagctccacgccgcgggtaag
gaattcaaggtcaacatctacaccggtgcgtccaccgcaccggactgcgatggtgtcatg
gccgaagcggacatcatcaactaccgcatgccttaccagggcgacccgtccctgcgtaag
tccatcaacgccggcaacgcgaagtaccaggacattcacttgtcccagtccccgcagtac
atcgagcagggcttcctccccatcgatgccgctatcgtcgaggccacccgcatcactgag
gaaggccacatcattccttcctccggaatcggcaacaacgttgaatacctggacaacgcg
gacaagatcattattgaggtcaactcctggcagtccctcgacctcgagggcatggcggat
atctaccgcatccagcgtctgccgaaccgcaccccgattccgatcaacgccccgggcgac
cgcatcggcaccccgtacatcgacatcaacctggacaaggttgtcgccgttgtcgagacc
aacgcccccgaccgcaacgcgccgtttaagccaatcgatgaaacttctcagcagattgcc
ggccacttcctcgacttcctcgacggcgaggtcgccgctggtcgcctggcatacgaccag
tacatcatgcagtccggcgtcggcaacgtcccgaacgctgtgatggcaggcctgcttgac
tccaagttcgaaaacatcaaagcttacactgaggttatccaggatggcatgctggatctg
atcgacgcaggcaagatgaccgtcgcgtcctcgacctccttctccctgtcccccgaggcc
gccgagaagatgaataacgaggccgcacgctaccgtaagcacatcatcctgcgtcctcag
cagatctccaaccacccggaggtcgtccgtcgcgtcggcctaatcgccaccaacggcatg
attgaggcggacatctacggcaacgtcaactccacccatatcaacggctcccgcgtgatg
aacggtatcggcggctcgggtgacttcacccgcaacgcgttcatctcctccttcatctca
ccgtcgctggcgaaggatggcgcaatctccgcagtggttcctttcgtctcgcacatcgac
cacaccgagcacgatgccatggtcatcatcaccgagcgcggcgtcgccgacctgcgtggc
ctggcaccgcgcgaccgcgtcgcaaagatgatctccatcgcgcacccggactaccagccg
ctgctcgaggaatactacgagcgcgcgctgaagaaggccccggcgctggctaccccgcac
gacctgcgcaccgccttcgacttccacatcaacatgattgagaagggctctatgaagggc
taa

DBGET integrated database retrieval system