KEGG   Corynebacterium lactis: CLAC_05290Help
Entry
CLAC_05290        CDS       T04042                                 

Definition
(GenBank) multifunctional uroporphyrinogen III methylase/precorrin-2 oxidase/ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
clw  Corynebacterium lactis
Pathway
clw00860  Porphyrin and chlorophyll metabolism
clw01100  Metabolic pathways
clw01110  Biosynthesis of secondary metabolites
clw01120  Microbial metabolism in diverse environments
Module
clw_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:clw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLAC_05290
Enzymes [BR:clw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CLAC_05290
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLAC_05290
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CLAC_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 VP9
Motif
Other DBs
NCBI-ProteinID: ALA67224
UniProt: A0A0K2GZL5
Position
1189606..1190697
Genome map
AA seq 363 aa AA seqDB search
MSLVLKDLGVLVIGGSTAAERVIPRFLDSGATITVCEGGEVTTAIEAWAADGRISLFRTS
FTPAMSWGKAIMVCCDESLLRDVTREGRRRGILVDDETGSASPLTPVALTGRRASRAGDL
AGQVALVGGGPGDPGLITVEGRRLLRLADVVVADHLGPLSLLGELDPDVEIIDAGKLPYG
RAMAQERINELLVHRAREGYFVVRLKGGDPYIFGRGFEELQELEEAGIPVRVVPGITSAI
AVPGSVGIPVTMRGINHDFTVVSGHVPPGHPKSLVDWDALGRMNGTICIIMGVKNGPEIA
ESLLASGRSADTPAAVVQEGTMSTQRSVRCTLGTLGETLVNEKIKPPAVIIIGEVVGLGG
SDA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggttctgaaagacctcggcgtgttggtgattggcgggtccacggctgcggag
cgagttattccgcgattcctggactccggcgcgaccatcactgtctgcgagggcggggag
gtaactactgcgattgaggcctgggcggccgacggtcgcatcagcctcttccgaaccagc
ttcaccccggccatgagctggggaaaggccatcatggtctgctgtgacgagtctctgttg
cgcgatgtcacccgggaggggcgccgccgtggcatcctcgtcgacgacgagactggctcc
gccagccccctgaccccggtcgcgctgaccggccgtcgtgcctcccgcgcgggagacttg
gcgggtcaggtcgcgctcgtcggaggtggcccgggcgatcccgggttgattacggtggag
ggccgtcgccttcttcggcttgccgacgtcgtcgttgccgaccacctcggcccgctgtca
ctgctgggggagttggacccggacgtggagattattgacgcgggcaagctcccgtatggc
cgagccatggcgcaggagcgtattaatgagctactcgtgcaccgcgcccgcgaggggtac
ttcgtcgtgcgcctgaagggcggcgacccgtacatcttcggccgcggattcgaggagctg
caggagctcgaggaagcgggcatccccgtacgggtcgttccgggcattacctcggctatc
gcggttcccggctccgtggggattccggtgactatgcgcggcatcaaccacgacttcacc
gtggtgtcgggccacgtcccgcccgggcatccaaagtcgctggtcgactgggatgcgctg
ggccggatgaacggcaccatctgcatcattatgggcgtgaagaacgggccggagattgcg
gagtcactcctagcttcagggcgcagcgccgatactcccgcggccgtggtccaggagggc
acgatgagcacgcagcgctcggtacgctgcacgctcggcacgctcggcgaaaccctagtc
aatgagaagattaaacctccggcagtaatcatcatcggcgaggtcgtggggctaggcggt
tcagatgcctaa

DBGET integrated database retrieval system