KEGG   Campylobacter lanienae: CLAN_0182Help
Entry
CLAN_0182         CDS       T05075                                 

Gene name
waaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
clx  Campylobacter lanienae
Pathway
clx00540  Lipopolysaccharide biosynthesis
clx01100  Metabolic pathways
Module
clx_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:clx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CLAN_0182 (waaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:clx01005]
    CLAN_0182 (waaD)
Enzymes [BR:clx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CLAN_0182 (waaD)
Lipopolysaccharide biosynthesis proteins [BR:clx01005]
 Unusual sugar
  CLAN_0182 (waaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short
Motif
Other DBs
NCBI-ProteinID: ARQ96953
UniProt: A0A1X9SL49
Position
177832..178800
Genome map
AA seq 322 aa AA seqDB search
MRVLITGGAGFIGSNLAKHFMGENEVLVVDKFRSNETFSNGNLKSFGHYKNLIGFRGDIY
CGDICDIDTIKKMRDFAPDVIYHEAAISDTTVAEQDEIMRVNLNSFKDILDIAYQNGSKV
VYASSGATYGDAPSPQSVGVGENPANVYGFSKLMMDEMGREYHAKTGLHIVGLRYFNVYG
DGEFYKNKTASMVLQFGLQILSGNAPRLFEGSDKIKRDFVYIKDIILANELAINGDSGVY
NVGTGNARSFQDIADILQREIGVSLGNEYIKNPFASQYQYFTQADISPTKIGLKYEPKYS
LEDGIREYLPAIKRIYNSEFRK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagagtattgataactggtggagcaggatttatagggtcgaatttggctaagcatttt
atgggtgaaaatgaagttttggtggtggataaattccgctctaatgagacttttagcaat
ggaaatttaaaaagctttggccattataaaaatttaattggctttagaggcgatatatat
tgtggtgatatctgcgatattgatacgatcaaaaaaatgcgtgattttgcgccagatgtg
atatatcacgaggctgctatctctgatactacggtggctgaacaagatgagattatgaga
gtgaatttaaactcatttaaagatattttagatatcgcataccaaaatggctctaaagtg
gtctatgctagtagcggtgctacatatggggacgctccaagcccacaaagtgtaggtgta
ggtgaaaatccggctaatgtctatgggtttagcaagcttatgatggatgagatggggcga
gagtatcacgctaaaacgggacttcatatagttgggcttaggtattttaatgtatatggt
gatggggaattttataaaaacaaaaccgcatctatggtattgcaatttggattacaaatt
ctaagtggcaatgccccaaggttatttgaaggaagtgataagataaaaagggattttgtt
tatataaaagatataattttagccaatgaattagcgataaatggcgatagcggagtctat
aatgtcggcacgggcaatgctagaagctttcaagatatcgctgatatcttacagcgagaa
atcggcgtaagcttaggcaatgaatatatcaaaaatccatttgcatcacaatatcaatac
ttcactcaagctgatatatcgcctacaaaaattggcttaaaatatgagccaaaatatagc
cttgaagatgggataagagagtatttgccagcgataaagcgaatttataatagcgagttt
agaaaatga

DBGET integrated database retrieval system