KEGG   Campylobacter lanienae: CLAN_0419Help
Entry
CLAN_0419         CDS       T05075                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
clx  Campylobacter lanienae
Pathway
clx00020  Citrate cycle (TCA cycle)
clx00620  Pyruvate metabolism
clx01100  Metabolic pathways
clx01110  Biosynthesis of secondary metabolites
clx01120  Microbial metabolism in diverse environments
clx01130  Biosynthesis of antibiotics
clx01200  Carbon metabolism
Module
clx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLAN_0419 (mqo)
   00620 Pyruvate metabolism
    CLAN_0419 (mqo)
Enzymes [BR:clx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CLAN_0419 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_9 Pyr_redox_2 Amino_oxidase Pyr_redox_3 Lycopene_cycl NAD_binding_8 Spermine_synth FAD_binding_2 FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ARQ97177
UniProt: A0A1X9SLP7
Position
411648..412994
Genome map
AA seq 448 aa AA seqDB search
MKEKHYEVVIIGGGISGGALLYELARYTDVKSIALIEKYSGLATLNSKGTANSQTIHCGD
IETNYTFEKAQKVSKTARMVVKYGLQHGYQGKYMFDGQKMAIGVGDVEVDYIKNRFNEFK
EIYPYLEFYDKAELAKIEPKIILNSDGTHRAENVVGMGVRSGEYTTVDYGAFTTTFIENA
KKEGGECDVYLNSRVDTITQNADKYYIQTADGLSISADFVVVNAGAHSLYLAHKMGYGLD
FGCLPVAGSFYLTKKKLLNGKVYMVQNPKLPFAALHGDPDILADGCTRFGPTALALPKLE
RYHDNWGSFLDFCKTLNFDSTIAGILFDLFKDSDIRNYILRNFLFEVPYLNKKLFVKDAR
KIVPSLSTSDIYYAKGFGGVRPQVLNKTEKKLMLGEASINPKTGIIFNMTPSPGATSCLG
NALRDVREVCEYLGKNFNEAKLNEELFD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaagcactatgaggtggtgataataggtggcggcattagcggtggtgcgtta
ctttatgagttagcaagatacacagatgtaaaaagcatcgcattaatagaaaaatactct
ggtctagctacgctaaattcaaaaggcacagcaaattcgcaaactatccattgtggagat
attgagacaaattatacatttgaaaaggctcaaaaagtcagcaaaaccgctagaatggta
gtcaaatatggcttacaacacggatatcaaggcaaatatatgtttgatggccaaaagatg
gcaatcggcgtgggcgatgtagaggttgattacattaaaaatagatttaatgagtttaaa
gagatatatccatatttggagttttatgacaaagcagaactagctaaaatagagccaaaa
attatattaaatagtgatggtactcatagagctgaaaatgtcgttggtatgggggttaga
agtggagaatataccaccgttgattatggggcattcacaactacatttatagaaaatgcc
aaaaaagagggcggagagtgcgatgtctatctaaattcaagagtagatactatcacgcaa
aacgcagataaatactatatccaaacagcagatggattatctattagcgctgattttgtc
gtagtaaatgctggtgctcactctttatatttagctcacaaaatgggatatgggcttgat
tttggttgtttgcctgtggctggtagcttctatctaactaagaaaaaactattaaatggc
aaggtttatatggtgcaaaatcctaaattgccttttgctgctttacatggtgatcctgat
attttggctgatggttgtacgagatttgggcctacggctttggcgctacctaagctagag
agatatcatgataactggggaagttttcttgacttttgtaagactttaaattttgactca
actattgctggtatattatttgatctatttaaagatagcgatattcgcaactatatctta
cgcaatttcttatttgaagttccgtatttaaataaaaaattatttgtcaaagatgctaga
aaaatcgtcccaagcctaagcactagcgatatatattatgctaaaggttttggcggtgtc
cgccctcaagtgcttaacaaaacagagaaaaaattaatgttaggtgaagctagtataaat
ccaaaaaccggaataatctttaatatgacaccaagccctggtgcgacaagctgccttggc
aatgcgttaagagatgttcgtgaagtttgtgaatatctaggtaaaaacttcaacgaagct
aaattaaacgaagagttatttgattaa

DBGET integrated database retrieval system