KEGG   Cellulophaga lytica DSM 7489: Celly_0411Help
Entry
Celly_0411        CDS       T01434                                 

Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00620  Pyruvate metabolism
cly00630  Glyoxylate and dicarboxylate metabolism
cly01100  Metabolic pathways
cly01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celly_0411
   00630 Glyoxylate and dicarboxylate metabolism
    Celly_0411
Enzymes [BR:cly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Celly_0411
    1.2.1.22  lactaldehyde dehydrogenase
     Celly_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADY28246
UniProt: F0RIC0
Position
425669..427123
Genome map
AA seq 484 aa AA seqDB search
MSSTKEYKLFINGEWVTSTSGETIAIVNPSTEEVVANVQNGTAEEALEALKAAEKAQKEW
KKLPARSRADMLYKLADEIDANTEHLAQLLTKEQGKLLKVARFEVAVTASFIRYACEGAR
RIEGDIIPSDNPNEQIWIQKVPRGVVVAITAWNFPLALAGRKLGPALVAGNSIVIKPTSE
TPLATLELGNLANNVGIPAGVLNIITGPGRAMGNALVESPITKMVTMTGSTPVGQQIAKN
AANNLTHVQLELGGKAPFIVFKDADIDAAVDAALHSRFDNCGQVCTCNERMYLHEDIYDI
FMEKFITKTKALKVGNPMLEDTDMGPKVNAAELKHMEHLVAVSVKEGATIATGGKKPEGA
EFEKGYWFEPTVLTNVTQDMTIVHEESFGPILPVLKFKTFDEVIGYANDCEYGLAAMVFT
NDMNTIMKCNDELEYGEIYVNRGHGEQHQGFHNGYKLSGSGGEDGKYGFEQYMEKKTFYI
KHKA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaactaaagaatacaagttatttattaacggagaatgggtaacatctacatct
ggcgaaactatagctattgtaaacccatctacagaagaagtagtcgcaaatgtacaaaac
ggcactgcagaagaagctttagaggcactaaaagcagcagaaaaagcacaaaaagaatgg
aaaaaattacctgcacgttctagagcagatatgttatataaattggcagatgaaattgat
gccaatacagagcatttggcccaactattaaccaaagaacaaggaaaacttttaaaggtt
gctcgttttgaggttgctgttacggcttcgtttattagatacgcttgtgaaggtgctcgc
agaattgaaggtgatattattccttctgataaccctaacgagcaaatatggattcaaaaa
gttccgcgtggggttgttgttgcaattacagcttggaattttcctttggctttggctggc
cgtaaattgggtccggctttggttgctggtaacagcattgtaattaagcctacatcagaa
acaccgttagcaactttagagttaggaaatttggctaacaacgtgggtattcctgctgga
gtactaaatattataactggccctggtagagctatgggtaatgctttggtagaaagtcct
attactaaaatggtaacaatgacgggttctacacctgttggtcagcaaatagctaaaaat
gctgcaaataaccttactcacgttcagttagagcttggtggtaaagctccatttatagtt
tttaaagatgctgatattgatgctgccgttgatgcagcattacattctagatttgacaat
tgcggacaagtttgcacctgtaatgaacgtatgtatttgcatgaagatatttacgatatt
tttatggagaaatttataacaaaaactaaggcattaaaagttggtaatcctatgttagag
gatacagatatgggacctaaagtaaatgctgccgagttaaaacatatggagcatttagtt
gctgttagtgtaaaagaaggggctacaattgcaactggaggaaaaaaaccagaaggagca
gaatttgaaaaaggatactggtttgagcctaccgttttaaccaacgtaacacaagatatg
actattgttcatgaagagtcttttggtcctattttacctgttttaaagtttaaaactttt
gatgaggttataggttatgctaatgactgtgaatacggacttgctgctatggtttttacc
aatgatatgaacaccattatgaaatgtaatgacgaactagaatatggagaaatttatgta
aatcgtggtcacggagagcaacaccaaggttttcataacggttacaaattatctggttct
ggtggcgaagatggtaaatatggttttgaacagtatatggaaaagaagacgttttacatt
aaacataaagcttaa

DBGET integrated database retrieval system