KEGG   Cellulophaga lytica DSM 7489: Celly_0413Help
Entry
Celly_0413        CDS       T01434                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00010  Glycolysis / Gluconeogenesis
cly00052  Galactose metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
cly01130  Biosynthesis of antibiotics
Module
cly_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_0413
   00052 Galactose metabolism
    Celly_0413
Enzymes [BR:cly01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Celly_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADY28248
UniProt: F0RIC2
Position
428249..429292
Genome map
AA seq 347 aa AA seqDB search
MKPIKSNFGSLNEQEIDLYTLKNANGMVVKITNYGATITSIQVPNAKEELVEIACGFDTL
DGYFSDEYKNNAPYFGSTVGRYCSQIKDATFILNGKKYELAKNCGPNNLHGGAVGFDKKI
WTVDTTSASENKLKLSLVSKNLEEGFPGNVNVSVTFTLTNSNELTISYSATTDADTPLSL
TNHTYFNLSGFTTSIENHTAQVYTNKRLKIDETGAATGEIIDVSNAVDDLTKPKKIADAH
NAMNDGFEHFYVFDTTEDEVTKVATIANENGQLSVDVFTTEPCMLLYTGKYTADNLKREN
GLKYGKYKGFCCETHRYPNGPNIKNSPKSITKAGENYKSTTVFKFSF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaataaaaagcaattttggatctctaaatgagcaagaaatagatttgtataca
ttaaaaaatgcaaacggaatggttgttaaaataaccaattacggagcaacaattacgtct
atacaagtgcctaatgctaaagaagaattagtagaaattgcttgtggatttgatacttta
gatggttatttttctgatgaatacaaaaataatgctccttattttggaagtaccgtaggt
aggtactgctcacaaattaaagatgctacgtttattttaaacggtaaaaaatatgaatta
gcaaaaaactgtgggcccaataatttacatggaggtgctgttggctttgataaaaaaata
tggacagtagatactacttctgctagtgaaaataaattaaagttatctttagtaagtaaa
aatttagaagagggctttcctggcaatgttaatgtatctgtaacatttacactaacaaat
agtaatgagttaaccattagctacagtgctacaacagatgcagacacaccattatcatta
acaaaccatacgtattttaacttatctggctttaccacatctatagagaaccatactgca
caagtatatactaataaacgtttaaaaatagatgaaactggtgccgcaacaggagaaata
atagatgtatctaatgctgtggatgatttaacaaagcctaagaaaattgcagacgcacac
aatgcaatgaatgacggttttgaacatttttacgtttttgatactactgaagatgaggta
acaaaagtagctaccatagctaatgaaaacggacaattaagtgttgatgtttttactaca
gaaccttgcatgttactgtacacaggtaaatacaccgcagataatcttaaacgagaaaac
ggacttaaatacggaaaatacaaaggattttgttgtgaaacacacaggtatcctaacgga
ccaaatattaaaaactctccaaaatctattacaaaagctggtgaaaattataagagcaca
accgtctttaaattttcattttaa

DBGET integrated database retrieval system