KEGG   Cellulophaga lytica DSM 7489: Celly_0656Help
Entry
Celly_0656        CDS       T01434                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00330  Arginine and proline metabolism
cly00332  Carbapenem biosynthesis
cly01100  Metabolic pathways
cly01130  Biosynthesis of antibiotics
cly01230  Biosynthesis of amino acids
Module
cly_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Celly_0656
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Celly_0656
Enzymes [BR:cly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Celly_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ADY28491
UniProt: F0RB89
Position
724152..724922
Genome map
AA seq 256 aa AA seqDB search
MEIKRVVVKVGTNVLTNKDNRILGPILKELVRQISVLYERDIMVVLVSSGSAIAGKEILG
ETNITDKSTRRQVYSSVGQPRLMRHYYSLFSDYGMRCAQVLATKRDFDLGVHRDNMINCY
EGLLSEGIIPIANEDDAVSVTMSMFSDNDELASLVAELIDADRLIILSDTDGLYTGHPDD
ENSKKISEVTYDQDVEKYVKASGKKEGEGRGGMASKLKIAKSTAKKEIPTYIANGKKQNV
IVDIIDNKKIGTKFIH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaagagtagttgtaaaagtaggtactaacgttcttacaaataaagataac
agaattttaggtccaattttaaaagaacttgtacgacaaatatctgttttatatgaaaga
gatattatggttgtactagtttcatctggctctgctatagcaggaaaagaaattttagga
gagactaatattactgacaaatctactagaagacaggtatattcttccgttggacagcca
agactaatgaggcactattacagcctttttagcgattatggtatgcgttgcgcccaagtt
ttagcaactaaaagagattttgatttgggtgtacatagagataatatgattaattgttat
gaaggtttactatctgaaggcataataccaattgccaatgaagatgatgccgtttctgta
acaatgtctatgttttctgataatgatgaattagcaagtttagttgcagagttaattgat
gcagacagacttattattttatctgatacagatggcttatacactgggcatcctgatgat
gaaaactctaaaaaaattagtgaggttacttatgaccaagatgtagaaaaatatgtaaaa
gccagtggcaaaaaagaaggcgaaggccgtggcggtatggcatctaaattaaaaatagca
aaaagtaccgctaaaaaagagattcctacttacatagcaaatggaaaaaaacaaaatgtt
attgtagatattattgataataaaaagataggaacaaaatttattcattaa

DBGET integrated database retrieval system