KEGG   Cellulophaga lytica DSM 7489: Celly_2272Help
Entry
Celly_2272        CDS       T01434                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00010  Glycolysis / Gluconeogenesis
cly00520  Amino sugar and nucleotide sugar metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
cly01130  Biosynthesis of antibiotics
cly01200  Carbon metabolism
Module
cly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_2272
   00520 Amino sugar and nucleotide sugar metabolism
    Celly_2272
Enzymes [BR:cly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Celly_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK AhpC-TSA_2 BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADY30092
UniProt: F0RGA1
Position
complement(2537626..2538387)
Genome map
AA seq 253 aa AA seqDB search
MEVLGIDIGGSGIKGALVNVKTGEKITERFRIPTPPTKKPKEMAKVVKKIIKHFNYNGPV
GCGFPTLIKNGICKTPGNLHKKWVDTDVTKLFSETTGLPFTVINDADAACYAEMNYGVGK
ELKGFVIMITVGTGLGSSAYLDGKLIPNFELGQIPYKKHKKIELWAADSARQREELSFKK
WGKRLNTFLQYVELLVAPDTIVIGGGISKEFDKFSKHIKINTPVIPAVLENHAGIIGAAS
ATIKNKKHKKKPL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacttggtatagacattggtggttctggaattaaaggagcacttgtaaacgta
aaaacaggagaaaaaattacagaacgatttaggattcctactccgcctactaaaaaacca
aaagaaatggctaaggtggttaaaaaaattattaaacattttaattacaacggaccagtt
ggttgtgggtttcctacgttaataaaaaacggaatttgtaaaacaccaggaaatttacat
aaaaaatgggtagacacagacgtgactaaacttttttctgaaactactggcttacctttt
acagttattaatgatgctgatgctgcttgttatgctgaaatgaactatggtgtaggtaaa
gagcttaaaggctttgtaattatgattaccgtaggtaccggcttaggaagtagtgcttac
ttagatggtaaactaattcctaattttgagttaggacaaataccatataaaaaacataaa
aaaatagaactatgggcagcagactctgccagacaaagagaagaactttcttttaaaaaa
tggggaaaacgtttaaacacttttctacaatacgtagagttgttagtagcaccagatact
atagttattggtggtggtatatctaaggagtttgataaatttagcaaacacataaaaatt
aatacccccgtaatacctgctgttttagaaaatcacgcgggaattataggcgccgcctct
gctactataaaaaataaaaagcataaaaaaaagcctttataa

DBGET integrated database retrieval system