KEGG   Chlorobaculum limnaeum: BIU88_10600Help
Entry
BIU88_10600       CDS       T04492                                 

Definition
(GenBank) magnesium protoporphyrin IX methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
clz  Chlorobaculum limnaeum
Pathway
clz00860  Porphyrin and chlorophyll metabolism
clz01100  Metabolic pathways
clz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BIU88_10600
Enzymes [BR:clz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     BIU88_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_11 CMAS Methyltransf_12 PrmA Ubie_methyltran NodS TehB MTS tRNA_U5-meth_tr UPF0020 PCMT Methyltransf_18 Methyltransf_32 Methyltransf_15 TPMT RrnaAD DREV AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: AOS84543
UniProt: A0A1D8D2Q8
Position
2348053..2348751
Genome map
AA seq 232 aa AA seqDB search
MSSPSFNVEEHKKMLQSYFNGQGFQRWASIYGNDKLSTVRSTVRQGHAVMMDKAFEWLQK
TGLAKGSKILDAGCGTGLFTIRLAKSGYRVKAADIASQMVNKTKEDAEKAGVAGNIEFEV
SSIESVSGTFDAVVCFDVLIHYPAEGFAHAFSNLASLTKGPIIFTYAPFNNILAFQHWIG
GFFPKKERRTTIQMIKDKEMQRVLGELGLKIVSQQKISFGFYHTMLMHVARR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcccatcattcaacgtcgaagaacacaagaagatgcttcagtcctatttcaat
ggccagggcttccagcgctgggcatcgatctacggcaacgacaagctctccaccgtccgc
tcaaccgtccggcagggccacgcggtcatgatggacaaggcgtttgaatggctccagaaa
accggcctcgccaaaggctcgaagattctcgacgccggctgcggcaccggcctcttcacg
attcgcctcgccaaaagcggctaccgcgtcaaggcggcggacatcgcctcgcagatggtg
aacaagacgaaggaggatgccgaaaaagctggcgtggcgggtaacatcgagttcgaggtc
agctccatcgagtcggtgtcgggtacgttcgacgccgtagtctgcttcgacgtactgatc
cactacccggcggagggattcgcgcacgccttcagcaacctggcgagcctcaccaaaggg
ccgatcatcttcacctacgcgccgttcaacaacatcctcgccttccagcactggatcggc
ggcttcttcccgaaaaaggagcgccgcaccaccatccagatgatcaaggacaaggagatg
cagcgggtgctcggcgaacttggtctcaagatcgtcagtcagcagaagatcagcttcggc
ttctaccacacgatgctcatgcacgtggctcgccgctga

DBGET integrated database retrieval system