KEGG   Caldivirga maquilingensis: Cmaq_0078Help
Entry
Cmaq_0078         CDS       T00611                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00010  Glycolysis / Gluconeogenesis
cma00052  Galactose metabolism
cma00500  Starch and sucrose metabolism
cma00520  Amino sugar and nucleotide sugar metabolism
cma00521  Streptomycin biosynthesis
cma01100  Metabolic pathways
cma01110  Biosynthesis of secondary metabolites
cma01120  Microbial metabolism in diverse environments
cma01130  Biosynthesis of antibiotics
cma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_0078
   00052 Galactose metabolism
    Cmaq_0078
   00500 Starch and sucrose metabolism
    Cmaq_0078
   00520 Amino sugar and nucleotide sugar metabolism
    Cmaq_0078
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cmaq_0078
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cmaq_0078
Enzymes [BR:cma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cmaq_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA
Motif
Other DBs
NCBI-ProteinID: ABW00932
UniProt: A8M9Q1
Position
complement(91627..92580)
Genome map
AA seq 317 aa AA seqDB search
MVDVTVVIDIGGSKIASALIYSDGKVEDYRVQSIDERGGEYAVNQVIETIRHYISGLSGV
NLIGVGISIPGIVRENGLVWAPNIRGWRNINVALMIKRKLNLSNLTIIDDRVANIMGEYW
QGAARGVSNAVSLMIGTGVAAGLLINGKPLRGSSGVAGAVGWWLLSRRIPRHKSSRGFLE
DQISGPALFRKTYRYCLRIRDESCLNIIRNCNTHNAHCIFQMLDQGVALIKPVLEEAATI
VGITAANLISLINPEVLVLSGGVGVEIGRRFMNTILKSVKVAQPHSLRRSRIVVSQLGYL
SNLYGLAHCIMSSNNCA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggttgatgtaactgtggttattgatattggtggatctaagattgcatcagcgttaatt
tacagtgatggtaaagttgaggattatagggttcaaagcattgacgagaggggaggtgaa
tatgcagtgaatcaagttattgaaactatacgacactacattagtggtcttagtggagtt
aacttaattggtgtaggaatcagcatacctggaatagttagggagaatgggttagtttgg
gcacctaacataaggggttggaggaatattaatgttgccttaatgattaagaggaagctt
aatctaagtaacttaaccattattgatgatagggttgccaacattatgggtgagtattgg
cagggggcagccaggggggtgagcaatgcagtgtcattaatgattggtaccggtgtggct
gctggattattaattaacggtaaaccattaagggggagtagtggtgttgcaggggcagtg
ggttggtggttactgagtaggagaatacctaggcataaatcatcaagaggattccttgag
gatcagatatcaggcccagcattattcaggaaaacatacaggtactgcctacgtatacgc
gatgaatcctgcctcaacattattaggaactgtaacacacacaatgcccactgcattttc
caaatgcttgatcaaggggtagcattaattaaaccggtgctagaggaggcggcgacgata
gtgggtattactgcggctaacttaattagtctaataaatcctgaggtattagtattaagt
ggtggtgtgggggtggaaattgggagaagattcatgaatactattctgaagtctgttaag
gtagctcaaccacactcccttaggagaagcagaattgtagtttcacagttaggttactta
tctaacctctacggcttggcccactgcataatgagtagtaataattgtgcatga

DBGET integrated database retrieval system