KEGG   Caldivirga maquilingensis: Cmaq_1047Help
Entry
Cmaq_1047         CDS       T00611                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00260  Glycine, serine and threonine metabolism
cma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cma01100  Metabolic pathways
cma01110  Biosynthesis of secondary metabolites
cma01130  Biosynthesis of antibiotics
cma01230  Biosynthesis of amino acids
Module
cma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cmaq_1047
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cmaq_1047
Enzymes [BR:cma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cmaq_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: ABW01876
UniProt: A8MDM0
Position
complement(1097700..1098428)
Genome map
AA seq 242 aa AA seqDB search
MGISRPALGLYLTATYPSTKRFLETLDKISGLVDFLEIGIPTRNPKYDGPVIRMAHQGAE
LMGLNAVKVTDDYSKYGKVPVLMGYISDYVNSLNDVAKTASDVGAATVLFPDLIFDYPEL
IGRYIEVMRSNGLAPSFFISSKTPYRLIRSLSEQEPLFIYLGLYAATGIKLPIYIEQNVV
TIRGVLGDAFLIVGFAVNSPDMVRSLIKAGADGVVVGSAFIQRMSDLNDALSFLKWLRGG
LP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggtataagtaggcccgccttgggcctatatttaacggcaacgtacccaagtactaaa
cgcttcctagagacccttgataagataagtggcctcgtggacttcctggaaataggcata
ccgacacgtaatcctaagtatgatgggccggttataaggatggctcaccagggtgctgag
ttaatgggtcttaatgcagttaaggttactgatgactacagtaagtatggtaaagtacct
gtgctaatgggttatattagtgattacgtgaactcactcaatgatgtggctaagacagct
agtgatgttggggccgccactgtattattccctgacctaatattcgattaccctgagtta
ataggtaggtacattgaggttatgaggagtaatggattagcccccagcttcttcatatca
agtaaaacaccctataggttaattaggagcctaagtgaacaggaaccattattcatatac
ctaggcctatacgcggccactggtattaagttgcctatttacattgagcagaatgtagta
actattaggggtgttttaggtgatgcattccttatcgtgggtttcgcagttaatagccct
gatatggttaggtcattgattaaggctggggctgatggggttgttgttggttcagccttc
attcaaagaatgagtgaccttaatgatgcgttaagcttccttaagtggcttaggggtggt
ttaccgtga

DBGET integrated database retrieval system