KEGG   Caldivirga maquilingensis: Cmaq_1168
Entry
Cmaq_1168         CDS       T00611                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00290  Valine, leucine and isoleucine biosynthesis
cma00770  Pantothenate and CoA biosynthesis
cma01100  Metabolic pathways
cma01110  Biosynthesis of secondary metabolites
cma01210  2-Oxocarboxylic acid metabolism
cma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Cmaq_1168
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Cmaq_1168
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Cmaq_1168
SSDB
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_2 F420_oxidored AdoHcyase_NAD ApbA
Other DBs
NCBI-ProteinID: ABW01995
UniProt: A8MDY9
Position
complement(1226291..1227277)
AA seq 328 aa
MAKIYRETDADLSELKGKVIAVLGYGIQGRSWALNMRDSGLRVIVGVRPGKSRDLAKEEG
FETYDVAEATKMADVVAVLLPDMVQPKVWTSEIGPNLKPGALVIFAHGFNIRYNLIKPPS
NIDVTLVAPKAPGKAVRDEYLRGWGVPALVAVHQDYTGKALRRALAVAKANGFTRVGVIE
TTFAEETETDLIGEQTVLVGGLMELIKKGFETMIELGYQPEVAYFEVLNEAKLIMDLIWE
RGVYGMLNGVSETARYGGLTVGPYVLDNSVKERMRKAAERVRNGEFAREWLNEYEGGMKN
LSRMLNEVKNHRLEVVGEDLRRLMRSGR
NT seq 987 nt   +upstreamnt  +downstreamnt
atggctaaaatatatagggaaacggacgccgacctatctgaattaaagggaaaggtaatt
gcagtgttaggctacggtatacaggggaggtcatgggcacttaacatgagggatagtggg
ttaagggttattgtgggtgtaaggccaggtaagagccgtgacctagctaaggaggagggg
tttgagacatatgatgtagccgaggccactaaaatggctgatgtagttgctgtgctactc
ccagacatggttcaaccaaaggtttggaccagtgaaatagggcctaacctaaaacccggt
gcattagtcatattcgcccatggtttcaacatacgctacaacttaattaaaccacccagc
aatattgatgtaaccctagtggcccctaaggcgccaggtaaggctgttagagacgagtac
cttagaggatggggtgtgcctgctcttgttgcggttcaccaggattacactggtaaggcc
ttgaggagggccttggctgtggctaaggcgaatggcttcactagggttggtgttattgaa
acaacattcgcggaggagactgaaacagacctaattggtgagcaaacagtgcttgtgggt
ggtttaatggagttaattaagaaggggtttgagacaatgattgaactcggctaccaacct
gaggtagcctacttcgaggtgcttaatgaggctaagttaataatggatttaatatgggag
aggggcgtttacggaatgcttaatggcgttagtgaaacagcaaggtacggaggattaaca
gtgggtccttatgttcttgataattcagttaaggagaggatgaggaaggccgcggagagg
gttaggaatggtgaattcgccagggagtggttgaatgagtatgaggggggtatgaagaac
ctcagtagaatgctgaatgaggttaagaaccatagattagaggttgttggggaggatttg
aggagactaatgaggagcggtaggtaa

DBGET integrated database retrieval system